KEGG   Streptococcus thermophilus ND03: STND_1818Help
Entry
STND_1818         CDS       T01978                                 

Definition
Threonine synthase, putative
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STND_1818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1818
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STND_1818
Enzymes [BR:stn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STND_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1711593..1713077)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLTTPEVTLDFDHLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDTAAIAPVVKLQNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPETEIIVFYPKDGVSKIQELQMT
TQAGANTHVIAIDGNFDDAQTNVKRMFNDVDLRKKLLTHHMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKAGHIKNGDKVNFTVPTGNFGNILAAYYAGQIGVPVGKIICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTKELMDALVTKGEYTLA
DADKGILDLFAAGFATEDETAAEIKRVYEEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVDIPAAVDGLERAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaacaataaagtaacagctagtcaggct
attcttcaaggattggcaacagatggtggcttgttcactccgctgacaacacctgaagtt
actttagactttgatcacttgaaagatgcttcttaccaagaagttgctaaattagttttg
tctgctttcttggatgattttactgaagaagaattggattactgtatcacaaatgcttat
gatgataagtttgatacagctgccattgctccagtggtcaaacttcaaaaccattacaac
cttgagctttttcatggttctaccattgctttcaaagatatggcgctttcaatattgccc
tatttgctaacaacatcagctaagaaacaaggtgttgataacaagattgttattttgaca
gcgacatcaggggatactggtaaagctgccatggctggttttgcagatgtccctgaaact
gaaattattgtcttttatccaaaagatggcgtttcaaaaatccaagaactgcaaatgaca
actcaagcaggtgctaatactcatgttattgcaattgacggtaattttgatgatgcccaa
acaaatgtgaaacgtatgtttaacgatgttgatttgcgtaagaaattgttgactcatcat
atgcaattctcatcagctaactcaatgaacattggtcgtttggtaccacaagtggtttac
tatgtgtatgcctatgcgcagttggtgaaggcaggtcatatcaaaaatggggataaggtt
aacttcacagtaccaacaggaaactttggtaacatcttggcggcttactatgcaggtcaa
attggtgttccagttggtaaaataatctgtgcttctaacgaaaataatgtccttacagac
ttctttgcaacaggtacttatgacaagaaacgtgacttcaaggtaacgacaagtccttct
atggacattttggtatcttctaacctagaacgcttgattttccatctccttggtaatgat
gcggttaagactaaagagcttatggatgcgcttgtgactaaaggtgagtacactttggct
gatgcagataaaggtatccttgatttgtttgcagcgggatttgcaactgaggatgaaaca
gctgctgaaatcaaacgtgtttatgaagaagacaagtatattgaagatcctcacacagcg
gttgcctcagctgtttacgaagcatacgttcaaaagacagatgatcacacaccaacagtt
atcgcttcaacagctagtccatacaagttcccacgtgtagcggtttcagctgttactggt
aaagatagtggtgatgacttcaaggcggtagaagacttgcaccaactttcaggagtagat
atcccagctgctgtagatggacttgaacgtgcagaagttcgccataaaacagttgttgct
gcagctgatatgcagaaagcagttgagagctatcttggtgtataa

DBGET integrated database retrieval system