KEGG   Streptococcus thermophilus ND03: STND_1818Help
Entry
STND_1818         CDS       T01978                                 

Definition
(RefSeq) Threonine synthase, putative
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STND_1818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STND_1818
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STND_1818
Enzymes [BR:stn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STND_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1711593..1713077)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDENNKVTASQAILQGLATDGGLFTPLTTPEVTLDFDHLKDASYQEVAKLVL
SAFLDDFTEEELDYCITNAYDDKFDTAAIAPVVKLQNHYNLELFHGSTIAFKDMALSILP
YLLTTSAKKQGVDNKIVILTATSGDTGKAAMAGFADVPETEIIVFYPKDGVSKIQELQMT
TQAGANTHVIAIDGNFDDAQTNVKRMFNDVDLRKKLLTHHMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKAGHIKNGDKVNFTVPTGNFGNILAAYYAGQIGVPVGKIICASNENNVLTD
FFATGTYDKKRDFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTKELMDALVTKGEYTLA
DADKGILDLFAAGFATEDETAAEIKRVYEEDKYIEDPHTAVASAVYEAYVQKTDDHTPTV
IASTASPYKFPRVAVSAVTGKDSGDDFKAVEDLHQLSGVDIPAAVDGLERAEVRHKTVVA
AADMQKAVESYLGV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgtataccaatcaacacgtgacgaaaacaataaagtaacagctagtcaggct
attcttcaaggattggcaacagatggtggcttgttcactccgctgacaacacctgaagtt
actttagactttgatcacttgaaagatgcttcttaccaagaagttgctaaattagttttg
tctgctttcttggatgattttactgaagaagaattggattactgtatcacaaatgcttat
gatgataagtttgatacagctgccattgctccagtggtcaaacttcaaaaccattacaac
cttgagctttttcatggttctaccattgctttcaaagatatggcgctttcaatattgccc
tatttgctaacaacatcagctaagaaacaaggtgttgataacaagattgttattttgaca
gcgacatcaggggatactggtaaagctgccatggctggttttgcagatgtccctgaaact
gaaattattgtcttttatccaaaagatggcgtttcaaaaatccaagaactgcaaatgaca
actcaagcaggtgctaatactcatgttattgcaattgacggtaattttgatgatgcccaa
acaaatgtgaaacgtatgtttaacgatgttgatttgcgtaagaaattgttgactcatcat
atgcaattctcatcagctaactcaatgaacattggtcgtttggtaccacaagtggtttac
tatgtgtatgcctatgcgcagttggtgaaggcaggtcatatcaaaaatggggataaggtt
aacttcacagtaccaacaggaaactttggtaacatcttggcggcttactatgcaggtcaa
attggtgttccagttggtaaaataatctgtgcttctaacgaaaataatgtccttacagac
ttctttgcaacaggtacttatgacaagaaacgtgacttcaaggtaacgacaagtccttct
atggacattttggtatcttctaacctagaacgcttgattttccatctccttggtaatgat
gcggttaagactaaagagcttatggatgcgcttgtgactaaaggtgagtacactttggct
gatgcagataaaggtatccttgatttgtttgcagcgggatttgcaactgaggatgaaaca
gctgctgaaatcaaacgtgtttatgaagaagacaagtatattgaagatcctcacacagcg
gttgcctcagctgtttacgaagcatacgttcaaaagacagatgatcacacaccaacagtt
atcgcttcaacagctagtccatacaagttcccacgtgtagcggtttcagctgttactggt
aaagatagtggtgatgacttcaaggcggtagaagacttgcaccaactttcaggagtagat
atcccagctgctgtagatggacttgaacgtgcagaagttcgccataaaacagttgttgct
gcagctgatatgcagaaagcagttgagagctatcttggtgtataa

DBGET integrated database retrieval system