KEGG   Streptococcus thermophilus ND03: STND_1821Help
Entry
STND_1821         CDS       T01978                                 

Definition
alcohol-acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stn  Streptococcus thermophilus ND03
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STND_1821
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STND_1821
   00620 Pyruvate metabolism
    STND_1821
   00650 Butanoate metabolism
    STND_1821
  Lipid metabolism
   00071 Fatty acid degradation
    STND_1821
  Amino acid metabolism
   00350 Tyrosine metabolism
    STND_1821
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STND_1821
   00626 Naphthalene degradation
    STND_1821
Enzymes [BR:stn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STND_1821
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     STND_1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714296..1714742)
Genome map
AA seq 148 aa AA seqDB search
MFSQMLSQIHLQYSFYKGLERFVDIQPDVIIALGGGSAMDAAKAIWMFFEYPDVSFFGAK
QKFLDIRKRTYKIPYAQKTQFICIPTTSGTGSEVTSFAVITDSETHIKYPLADYALTPDM
AIVDPALVISVPASVTADTGMDRFDARY
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttttctcagatgttgagccaaatccatctacaatacagtttttataaagggttggaa
cgttttgtagacatccaaccagatgttattatcgctcttggtggtggttctgcaatggat
gctgctaaggctatctggatgttctttgaatacccagatgtaagcttcttcggcgctaaa
caaaaattcttggatatccgtaaacgtacctacaagattccttacgctcagaagacacaa
ttcatctgtatcccaacaacttcagggacaggctcagaagtgacgtcatttgcggttatc
actgatagtgaaacccacatcaagtatccattggcagattacgctttgactccagatatg
gccatcgttgaccctgctttagtaataagtgtgcctgctagtgttacagcggatacaggt
atggaccgttttgacgcacgctattga

DBGET integrated database retrieval system