KEGG   Sulfolobus tokodaii: ST0038Help
Entry
ST0038            CDS       T00062                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ST0038
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST0038
  Lipid metabolism
   00071 Fatty acid degradation
    ST0038
  Amino acid metabolism
   00350 Tyrosine metabolism
    ST0038
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ST0038
   00626 Naphthalene degradation
    ST0038
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ST0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(56081..57004)
Genome map
AA seq 307 aa AA seqDB search
MRGFAELIYIYKREFGKDVFNPKLPFTIGHENVGIIEEVGSAVDWLSKGDPVILHPYITC
RHCKACRAGNDMHCPNGKFPGLDGTDGGYAEYLKTSAYSAIKLPKNVDPTPMAPLADAGL
TAYHAVKKLKLDPDSKVVVIGIGGLGHIAVQILKAITPATIIAVDVSEDRIKLAKELGAD
EGVIAGADGGVNEVLKLTNNEGADAVLDFVGEHGTPKNAIRMIKKGGIYSIVGYGGEFTN
TTLDFISREISVIGNLVGTYNELAELVELYAREKVKLRTQMFRLEEANKALEMLKSGKIA
GRAILVP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggggtttgcagaactgatttacatatacaagagggaatttggaaaggatgtattt
aatccaaaattacccttcaccattgggcatgaaaatgtaggaataattgaggaagttggt
agtgctgtggattggttaagtaaaggagacccggtaatcctacatccctacataacttgt
aggcactgcaaagcatgtagggctgggaatgatatgcattgtcctaacggtaagttccca
gggcttgatgggactgatggaggttatgctgagtatttaaagacatcagcttattcagct
ataaaattgcctaaaaatgtagacccaacaccaatggcaccattagcagatgctgggtta
acagcgtatcacgcagtaaagaaattaaaactagatcccgacagtaaggtggtagtgata
ggaataggaggattggggcatatagcagtacagatattaaaggcaataacgccggcaaca
ataatagctgttgatgttagtgaggataggattaaattagctaaggaattgggagctgat
gaaggagtaatagctggagctgatggaggagttaatgaggtattaaagttgactaataat
gagggggcagatgcagtactggattttgtaggtgagcatggtacacctaagaacgctata
aggatgattaaaaaaggaggaatatattccattgtgggttatggtggagaatttactaat
acgacactggatttcatcagtagagaaataagtgttatagggaatttagtggggacatat
aatgagttagcagaattagttgaattatatgcaagagaaaaagtgaaattaagaacgcaa
atgtttaggttagaggaggcaaataaagcattagaaatgcttaagagtggaaaaatagct
ggaagagcaatattagtaccgtaa

DBGET integrated database retrieval system