KEGG   Sulfolobus tokodaii: ST0214Help
Entry
ST0214            CDS       T00062                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sto  Sulfolobus tokodaii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ST0214
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ST0214
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ST0214
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236750..237760
Genome map
AA seq 336 aa AA seqDB search
MVTFPTLRPRRLRKNKLIRDLVAETNLTASGLIQPIFIKENINEPEKIDSMPGVYRYPPN
DHLIKFVEEVYSFGVKNFILFGIPSFKDEFASSAYDKNGIIQKSLRLLRQTFGEKILLIT
DECTDEYTSHGHCGIITQKDGKLCVNNDESLKVHALIAVSQAEAGADIIAPSSMMDGVVG
AIRKALDEAGFTDTAIMSYSVKYASTFYSPFRDAAYSKPAFGDRRGYQMDPRNAFEALKE
ASLDIEEGADILMVKPAHTYLDVIRLVKTTFPQYPLAAYHVSGEYSMIKAAALNGWIDEK
TAVLEITTAIKRAGADLIITYYAKDIANWIKEGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtaacatttccaactctaagaccgaggaggctaaggaaaaataagttaataagagac
ttagtcgcagaaacaaacttaactgcttctgggttaatacagcctattttcataaaagaa
aatataaatgaaccagaaaagatagatagcatgcctggtgtttatagatatccacctaat
gatcacttgataaagtttgtcgaagaagtttatagttttggcgtaaagaattttattctc
ttcggaataccctcatttaaagatgaatttgcatcatcagcatacgataaaaatggaata
atacaaaaatcactaagactgcttaggcaaactttcggagagaaaatattactaattact
gatgaatgtacagatgaatatacctctcacggacattgtggaattattacacaaaaagat
ggaaaactttgcgtgaacaatgacgaaagcctaaaagttcatgcacttattgcagtcagc
caagctgaggcaggagctgatattatagcaccttcatcaatgatggatggtgttgttgga
gctattaggaaggcattagatgaagcgggttttacggatactgcaataatgtcgtatagt
gtaaaatacgcatcaacgttttattcaccttttagagatgcagcatattctaaaccagct
tttggtgatagaagaggataccaaatggatccaagaaacgcctttgaagcattgaaggag
gctagtttagatatagaagaaggagctgatattcttatggtgaaaccggctcacacttat
ttagatgttataagattagtaaagacaaccttcccacaatatccattagctgcgtatcat
gttagtggagaatatagtatgattaaagcagcagccttaaatggatggatagatgaaaaa
acagctgttttggaaataactactgcaataaagagagctggtgcagatttaattataacg
tattatgctaaagacatagctaattggataaaagaaggtgtacctttttga

  All links  
No link information was found.   
DBGET integrated database retrieval system