KEGG   Sulfolobus tokodaii: ST0218Help
Entry
ST0218            CDS       T00062                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sto  Sulfolobus tokodaii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ST0218
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ST0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239878..240513
Genome map
AA seq 211 aa AA seqDB search
MKVLFLRPEGSNIPYNKNFIEISILKPECINYTVNLHEIDGLGFTSINAVRCFKDFDKIE
GKAIFAVGPSTSEELIKRNIKNVIIPEEYTVENLVKLIKQNTKNPLLVRSLIAIDNSLDI
KQIADYNLKADLQKLEEARELIEKCKVNIIVLTSSYIASLVKDFIKECEIIVSIGPSTSK
VIKDKKNIYEAKEHDMKGILKLLKELGAYDG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtattattccttaggcccgaaggatctaatattccttataataagaattttatt
gaaattagtattttaaaacctgaatgtataaattatactgttaatttacacgagatagac
ggccttggattcacgagtattaatgcagtaagatgttttaaagactttgataaaattgaa
ggaaaagctatatttgccgtaggacctagtacatcggaagagctaattaagcgtaatatt
aaaaatgtgattataccagaagaatatactgtagaaaatctggtaaaactaataaagcag
aatactaaaaatccacttctagttaggagtttgatagcaatagataacagtttagatatc
aagcaaattgctgattataatttaaaagcagatttacaaaaactagaagaagccagagag
ttaattgaaaaatgtaaagttaatataatagttttaactagctcttatatagctagttta
gtgaaagattttataaaagaatgtgaaataatagtaagcataggtccgtctacttctaaa
gtaattaaagataagaaaaacatatatgaagcgaaagagcatgatatgaaaggaatttta
aaattattaaaagaattgggtgcttatgatggatga

DBGET integrated database retrieval system