KEGG   Sulfolobus tokodaii: ST0242Help
Entry
ST0242            CDS       T00062                                 

Definition
phospho-sugar mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST0242
   00030 Pentose phosphate pathway
    ST0242
   00051 Fructose and mannose metabolism
    ST0242
   00052 Galactose metabolism
    ST0242
   00500 Starch and sucrose metabolism
    ST0242
   00520 Amino sugar and nucleotide sugar metabolism
    ST0242
  Nucleotide metabolism
   00230 Purine metabolism
    ST0242
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ST0242
Enzymes [BR:sto01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ST0242
    5.4.2.8  phosphomannomutase
     ST0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(261313..262680)
Genome map
AA seq 455 aa AA seqDB search
MGKLFGTDGVRGIVNKELTPELVLKLSKAIGTFFGKNSKILVGRDVRAGGDMLVKIVEGG
LLSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRREK
ENEIEDLFFTERFNTIEWSSLTTEVKREDRVISTYVNGILSHVDIEKIKKKNYKVLIDPA
NSVGALSTPLVARALGCKIYTINGNLDPLFSARQPEPTFDSLKETAEVVKTLKVDLGVAH
DGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVSSSSLVEEYLSKYNI
QVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSFALMLELLANENVSS
AELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITIDGVKIIGKDFWFLV
RKSGTEPIIRIMAEAKDENVANNLVNELKKIVEGK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctttttggtactgacggagtaagagggatagttaataaagagttaactcca
gaattggtattaaagctttctaaagctatagggacattttttggaaagaatagtaaaatt
cttgtaggcagggatgtaagagcagggggtgatatgttagttaaaattgttgaaggtggt
ttactaagtgtaggtgttgaggtttatgatggtggtatggctcctacaccagctttacaa
tatgctgtgaaaactttgggttatgatggtggagttgtaattactgctagccataatcca
gcaccatataatgggataaaagttgttgataaggatggtattgaaataagaagagagaaa
gaaaatgaaatcgaggacttattttttactgaaagatttaatactatagaatggagttct
ctaactacagaagttaagagagaagatagagttatttctacttatgtaaatggaatttta
agtcatgttgatatagagaaaattaaaaagaaaaattataaggtattaattgatccggct
aatagtgtaggtgctttatctactccattagttgctagagctttaggttgtaagatttac
acgattaatggaaatcttgatcccttattttcagctagacaaccagagcctacttttgat
agtcttaaagagactgcagaagttgtaaagactttaaaagtggacttaggtgtagcacac
gatggtgatgctgatagagccatttttattgattctgaaggaagagtacagtggggtgat
aggagtggtactttattatcatattgggcatctgttaaaaatcctaaagctataaagaag
attgttactgctgtttcaagctcaagcttagtagaagagtatttaagtaaatataatatt
caagttgattggacaaaagtaggaagtgttgatatagcacataaggtagcggatgagaat
gcactagctgggtttgaagaaaatggaggttttatgtatcctccacatcagtatgtaagg
gatggtgcaatgagttttgctttaatgttagaattactagctaatgaaaatgtttcgtca
gcagagctatttgataggcttcctaaatattatcttgtaaaaactaaggttgacctaaag
ccagggttaatggttgaggaaatttataagaaaatattagaagtatattcaacttctagt
gttaaagcaataactatagacggagtcaaaatcataggtaaagatttctggtttcttgta
aggaaaagtgggactgaacctataataagaataatggctgaagctaaagatgaaaacgta
gcaaataatttagttaatgaattaaaaaagattgtagagggtaaatga

DBGET integrated database retrieval system