KEGG   Sulfolobus tokodaii: ST0352Help
Entry
ST0352            CDS       T00062                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sto  Sulfolobus tokodaii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ST0352
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ST0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(373125..374012)
Genome map
AA seq 295 aa AA seqDB search
MSDSRLLYLNENSRLFAGFNKPTSPFVIIGLPLDITSSFRPGSRFAPSTIREYAQFIEFY
SIRTGIDMGEVGFNDVGDVVMHPSDVEENIRRISDVTSYFAEKGKIIIGIGGEHSVTVGT
VRGIKPDCVLSIDAHLDLRDEYMGYKYDHACVMRRISEQGVKIMEIATRAVSKEELDYAN
KNGIAYLTPHQIRLLGVRETAKKIVNNFRDCEKIYVTYDMDGIDPAYAPGVATPEPEGLD
PTTVLDIISLIIDKRVVGFDVVEVSPPHDPSGITSVLGARIILETSAQIYKARSL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatagcaggttactatacttaaatgaaaatagtagattatttgccggatttaat
aaaccaacatctccatttgttataattggtctaccattagatataacaagtagtttcaga
ccaggttccagatttgcaccatctaccataagagagtacgcacaatttattgagttttat
tctataagaactggaatagatatgggagaagtagggtttaatgatgtaggagatgtagta
atgcatccctctgatgtagaagaaaatataagaagaatatcagacgtaactagttatttt
gccgaaaaaggaaaaataataataggtataggtggagaacattctgtaactgtaggaact
gtaagaggaattaaaccagactgtgtacttagtattgacgcacatctagaccttagagat
gaatacatgggttataaatacgaccacgcttgtgttatgagacgaatatcagaacaggga
gttaaaataatggaaatagctacaagagctgtctctaaagaagaattagattacgcaaat
aaaaacggaatagcttatcttacaccacatcaaataagattattaggagtaagagagact
gcaaagaaaattgttaacaatttcagagattgtgaaaaaatctatgtaacatatgatatg
gatggaatagatccagcatatgctccaggtgtagctactccagagcctgaaggattagac
ccaactacagtactagatattatatcgcttataatagataaaagagttgtaggctttgat
gtagtagaagtttcaccacctcatgatccatctggaataacttcagtattaggagccaga
ataatcttagaaacatctgcccagatttataaggctagatcgctttaa

DBGET integrated database retrieval system