KEGG   Sulfolobus tokodaii: ST0692Help
Entry
ST0692            CDS       T00062                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sto  Sulfolobus tokodaii
Brite
Enzymes [BR:sto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ST0692
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    ST0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676291..677703
Genome map
AA seq 470 aa AA seqDB search
MLVRKPIRMLSGVTIVSVMTHPHRCPHGKCIFCPGGVEYGTPQSYYGNEPTLMRAIENNY
DPFYQVHSRLKQYEANSHIPSKVELIIMGGTFLSTPIDYQEWFVSQALEAMNRYPSDEKP
KFVYLEDAQLRNETANVRCVGMTVETKPDWAKEWHADQMLRLGVTKVELGVQTVYDDILK
KTNRGHTVKDSIEATRILKDAGFKIVYHVMLGLPGSDPDKDLEAFKTLFKDPDFRPDMLK
IYPTLVVETAPLAELWKRGLYKPYDTETLVELISEMYRYIPPWVRVMRIQRDIPANIILD
GNKKGNLRELVEKRVKEKGIKNNEIRFREVGIRWFHDGILPKEPKLKKIEYEASEGTEVF
LSFEDDDGILIGYLRLRYPSDKAHRPEINSKTTIVRELHVYGPEVPVDMLDDFSFQHKGY
GSKLLMEAERISVDEFGAKRILVLSGIGAREYYRKKGYYKYGPYMAKDLA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgttagtgagaaaaccaataaggatgttatctggtgttacaatagtctctgttatgact
catcctcatagatgtcctcacggtaaatgcatattttgtcccggtggtgtagaatacggg
actccacaaagttattatggtaatgagcccacattaatgagggctatagaaaacaattat
gatccattttatcaagttcattctaggctaaaacaatatgaagcaaatagccatattccc
agcaaagtcgagttaataataatgggtggaacttttctttctacacctattgattaccaa
gaatggttcgtttcacaagcactagaagcaatgaataggtatccctctgatgaaaaacct
aaattcgtttatttagaagacgcacagttgagaaatgaaacagcaaacgtaagatgtgta
ggaatgactgttgaaacaaaaccagattgggctaaggaatggcatgctgatcaaatgtta
agattaggagttactaaagtggaattaggcgtgcaaacagtatatgatgatatattgaaa
aaaactaatagagggcatacagttaaagactcaatagaggcaactaggattctaaaggat
gctggtttcaaaattgtttatcacgttatgttaggtttacctggatcagatccagataaa
gatttagaagcttttaaaacactatttaaagacccagatttcagaccagatatgctaaag
atttatccaactttagttgttgaaactgctcctttagctgagctttggaagagaggactt
tataaaccttatgatactgaaacattagttgaattaatttctgaaatgtacagatatatt
cccccatgggttagggtaatgaggatacagagggatattccagcaaatattattcttgac
ggtaataaaaagggaaacttaagagaactagtagagaagagggtaaaagaaaagggaatt
aaaaacaatgaaattaggtttagagaagttgggataaggtggttccatgatggtatttta
ccaaaagaaccaaaattaaagaagattgaatatgaagcaagtgaaggtactgaagttttc
ctctcatttgaagatgatgatggtatcttaatcggttatttgagattgaggtatccttct
gataaagctcacagaccggaaattaattcaaagactactattgttagggagttgcacgta
tatggtccagaagtcccagttgatatgttagatgatttctctttccaacataagggttat
ggaagtaaactactaatggaggcagaaaggatttcagtggatgaatttggtgctaaaagg
attttagttctttcgggaataggcgcgagagaatactataggaaaaaaggatattataag
tacggtccttatatggcaaaagacctagcgtaa

DBGET integrated database retrieval system