KEGG   Sulfolobus tokodaii: ST0773Help
Entry
ST0773            CDS       T00062                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sto  Sulfolobus tokodaii
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ST0773
  Lipid metabolism
   00600 Sphingolipid metabolism
    ST0773
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ST0773
Enzymes [BR:sto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ST0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(752547..753701)
Genome map
AA seq 384 aa AA seqDB search
MKLGFSISAFQYEELNENSDWYLWLTDEINITSKRVIGELPGKNFYLSKFSQIHDIASRL
NASFWRLNLSWGRIFKERDKISVEAVTGYRKLLKDLKDRGFKVILCLNHFDLPKWVHDPI
IARDSLLTEGPLGWYSEDTINHFISFSSFVKDNFSEYVDLWCTFNEPNIMILFGYLSGIF
PPGITSRRAYEKALKNVLTAHREVYNLFHGEKVGIIFNFPYIQGNEKAKEELFTTLKGIS
FDWIGVNYYTRIVVNEKGQPVDGYGMFCKPNSFSLDNNPCSDYGWEVYPEGLKHVLQGVK
KFDKPIIVTENGIADSKDFLRPSFLISHVEAIKESKVNVEAYLYWSLIDNFEWNFGYQMK
FGIYTLDLKARPSAYIFKELTSFV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggtttctcgatttcagcattccagtacgaggaactgaatgagaattcagat
tggtatttgtggttaacagatgagattaacataacaagtaagcgagtaataggagaatta
ccaggtaagaatttctatctctctaagttttctcaaattcacgatatagcttctaggctt
aacgcatcattctggagactgaacttaagttggggaaggatatttaaggaaagagataaa
atctctgtagaagctgtaactggatatagaaaattactcaaagacttgaaagatagagga
tttaaggttatattatgtcttaatcatttcgatcttcctaagtgggttcacgatccaatt
attgctagagattctctcttaactgaaggacctttaggttggtattcagaagatacgatt
aatcactttatatctttttcgtcttttgtgaaagataatttttccgaatacgtagatctt
tggtgtacctttaacgaacctaatataatgatactttttggttatttatctgggattttc
ccacctgggataacgagcagaagagcatatgaaaaagccttgaaaaatgtcttaactgca
catcgagaggtttataacctatttcacggagagaaagtaggaatcattttcaattttccg
tatattcagggtaacgagaaagctaaagaagagcttttcacaactttgaaaggcataagc
tttgattggattggtgtcaattattatacaagaatagttgttaatgagaaaggacaacca
gttgacggttatggtatgttttgtaaaccgaattctttttcattagataataatccttgt
tccgattacggctgggaagtttacccagaggggctaaagcatgtcttacaaggcgtgaaa
aaattcgataaaccaattatagtaactgagaatggtattgctgattccaaagatttcctt
agaccaagtttcttaatatcgcatgtggaagctataaaggaaagtaaagttaatgttgaa
gcctatctatactggagtttaattgataattttgaatggaatttcggctatcaaatgaag
ttcgggatttacacactcgacttgaaggcaagacctagcgcttatatcttcaaagaatta
acttcttttgtctga

DBGET integrated database retrieval system