KEGG   Sulfolobus tokodaii: ST0940Help
Entry
ST0940            CDS       T00062                                 

Definition
oligosaccharyl transferase
Orthology
K07151  
dolichyl-diphosphooligosaccharide--protein glycosyltransferase [EC:2.4.99.18]
Organism
sto  Sulfolobus tokodaii
Pathway
Metabolic pathways
Brite
Enzymes [BR:sto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     ST0940
Glycosyltransferases [BR:sto01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   ST0940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
914294..916597
Genome map
AA seq 767 aa AA seqDB search
MQSSTKVIPKFDKFKFLDVAVISGLVIVSILIRTVNMLAFPQSVNEFDPWYLFYNALLIA
QSGGNWYAVPPDVHGWFPWGYFIELGNTIGLPWLVSLFSLPFYGQFGSNAVYTVAVLSDI
LLDGLGVVAAFLAIDVITENRIGAYIAAAIVAVSPSLTYKNLLGGLPKTSWGGVFVLFSI
YFVTLAIKRKNPLYGIPAGIMIFLANITWGGYTYIDLSLAISAFLLVLLNKNDEITAKTL
TILAVTSAFLTSLAPNNIGFMSGLAHGLSLLVIPLFLYIELYIRQIIPKEILDSKNILIG
AAIVFILALGILGLAALGKSPIPSRYYAIVNPFYQFSVPIDRTVAEYIPQPVTAMIQDFG
ISLFLSIIGMYFVITRRAQLPGLWLLILGVASIYGTSEQPYLFNYTAYIVAALAGLGVAE
IANRFAESKSRGIRIAPLIMLGIIGVSLLADAGISMEISYEPTAIYNAATSFLTTNYAWI
SALDWINHNTPKNAFILSWWDYGYWIEVVGNRSVIDENNTLNGTQIKLMAEMFLNNESFA
VNVLESDFHLYPYGSPNYTIPVYIVAYDAVTQYISSSGQSVWFIGYPTNFPGEFIGYTTS
LGDIAKAMGAMTIIAGYNMYSYVNFTYVNETATTLAEAGQTQLASIVANSLPMAWTPKAY
NSLIVNMFIEGVQALNQGPVQAPFSISLSQLSSALGGNATLINPSGILPNVVLPYFRPVY
ISLYPVTAEPAVGGEAIVYIIVVVYQFVEPNVILPLIIQENGTTINT
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcaagtactaaggttattcctaaatttgataaatttaaatttcttgacgttgct
gttataagtggactagttatagtatctattctaataagaacagtaaatatgcttgccttt
cctcaaagtgtaaatgagtttgatccttggtatcttttctataatgcccttttaattgcc
cagagtggtggaaactggtatgctgtaccaccagatgttcatggttggtttccatggggt
tatttcatagaactgggaaatactatcggattaccatggctagtctccttgttctcatta
cctttttatgggcaatttggttctaatgcagtatatacagttgcagttctctctgatata
cttttagatggtttaggagtagttgctgcattcctcgctattgatgtaattactgagaac
agaattggtgcatatattgcagctgctatagttgcagtttctccatcacttacatacaag
aacttacttggtggattaccaaaaacttcatggggtggagtatttgtactcttttcaata
tacttcgttactcttgctattaagagaaagaaccctctttatggtattccagcaggtata
atgatatttttagctaatattacgtggggagggtatacttatattgacttaagtctcgca
atttctgccttcctcttagtgttgcttaataaaaatgatgagattactgcaaagacctta
actatattggctgttacttcagcttttcttacgtcattggctccgaataatattggtttc
atgtcagggttagctcacggtttgtcactccttgtaattccattattcctctatatagag
ctttacattagacaaattattcctaaagaaatattagactcaaagaacatactaattggt
gctgcaatagtatttattctagcattaggaattttaggtttagccgctttaggaaaatct
ccaataccatcaagatattatgcaatagttaatccattctaccagttctcagtacctata
gataggacagtagctgaatatattcctcaacctgtaacagcaatgattcaagatttcgga
atatcattatttctttctataataggaatgtacttcgtaattactagaagggctcaatta
cctggtttatggctcttaattttaggcgttgcaagtatttatggaacttcagagcaacca
tatttgtttaattataccgcatatattgttgcagcattagctggtttaggtgttgctgag
attgcaaatagatttgcagaaagtaagtctaggggtataagaatagcaccattaatcatg
ctaggaattattggtgtatctctattagctgatgctgggatatcaatggaaattagttat
gaacctacagctatttataatgcggcaacctcatttttaactactaattatgcatggata
tcagcattagattggataaatcataatacacctaagaacgcctttatactaagttggtgg
gattatggatattggattgaagtagtgggtaatcggagtgttattgatgaaaataatacg
cttaatggtactcaaattaagcttatggcggaaatgtttctaaacaatgagagttttgct
gttaatgttttagagagcgattttcatttgtatccttacggaagtcctaactatactatt
ccagtatatatagtagcttacgatgctgtaacccaatacatttcaagttctgggcaatca
gtatggtttatcggttatccaacaaactttcccggagaatttataggttatactacaagt
ttgggcgatattgctaaggcaatgggtgcaatgacaattatagctggttataacatgtat
agttatgttaatttcacttatgttaatgaaaccgcaacaactttagccgaggcgggacaa
actcaattagcttcaatagttgctaactcattgccaatggcttggacgcccaaagcatat
aattcattgatagttaacatgtttattgaaggagttcaagcattaaatcaaggtccggtt
caggctccattttcaatatcattaagtcagttatcttcagcacttggtggtaatgctact
ttaattaatcctagtggtattttgccaaatgtggttttaccctactttagaccagtatat
atttcactttatccagttactgctgagcctgcagtaggcggggaagcaatagtatatatt
attgttgtagtttatcagtttgtagaaccaaatgttattctacccttaataattcaagaa
aatgggactacaataaatacttaa

DBGET integrated database retrieval system