KEGG   Sulfolobus tokodaii: ST1123Help
Entry
ST1123            CDS       T00062                                 

Definition
L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sto  Sulfolobus tokodaii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1116959..1117654)
Genome map
AA seq 231 aa AA seqDB search
MSEKEEILRKIKTQELAEAFNKVDRSLFLPENLKDYAYAHTHEALPILPGINTTALNLGI
FMLDELDLHKGQKVLEIGTGIGYYTALIAEIVDKVVSVEINEKMYNYASKLLSYYNNIKL
ILGDGTLGYEEEKPYDRVVVWATAPTLLCKPYEQLKEGGIMILPIGVGRVQKLYKVIKKG
NSPSLENLGEVMFGRIGGLYGFYDDYDDIEFRVNKLERQIKSILDNLVKKT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaagaggaaatattgagaaagattaagactcaggagctagctgaagctttc
aataaagtcgataggtctttattccttccagagaacttaaaggattatgcatatgctcat
acacacgaagctctgcctattctaccgggtataaatactactgctcttaacttgggaatt
tttatgctagatgagctagaccttcataagggacagaaggttcttgaaataggaacaggg
ataggatattatactgctttaattgctgaaattgtcgataaagttgtaagcgtagaaata
aatgagaaaatgtataactatgcttccaaactcctctcttattacaataatataaaactt
atacttggagatgggactttaggatatgaggaagaaaaaccctacgacagagtggtcgtt
tgggcaacagcacctacgcttctttgtaaaccttacgaacagcttaaagagggaggaata
atgattttgccaataggagttgggagagtgcagaaactttacaaagtaattaagaaagga
aatagcccttcgcttgagaacctaggggaagttatgttcggaagaattggaggtctttac
ggtttttatgatgattatgatgatattgaatttagagttaataaattagaaagacaaata
aagtcaatattagataatttagtaaagaaaacttaa

DBGET integrated database retrieval system