KEGG   Sulfolobus tokodaii: ST1190Help
Entry
ST1190            CDS       T00062                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST1190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST1190
   00620 Pyruvate metabolism
    ST1190
   00640 Propanoate metabolism
    ST1190
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST1190
   00680 Methane metabolism
    ST1190
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST1190
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192241..1193734
Genome map
AA seq 497 aa AA seqDB search
MVSYYEVVRSFSWKEIEKTIDISSLVDHEGVAVIRFSKEGKEQITFQELKDKALRLASYL
KHIAGVKKGDVISVLASKKIEQVIVLLASLYIGALYQPLFTAFGPKAIEIRTRDKKPKVL
FYQDDQKEKVSEGVPLSKLDELTSYGRLEEIERLSWNDPIILLYTSGSTGLPKGALISKR
LLLNTYVYMKYGIGLRENDIFWNGADPGWAYGLYYGIIGPLLFGKTVIFLDEPFDAERTM
EFLEENKITNFAWAPTTYRIISRSVKRKYDLRLERASSAGEPLNPEVIKWFKDNYNVIVK
DHYGQTEVGMVVYNGWGYDYELKIGSMGLPAPGYEVDIIEENIAVKKTSPGFHFLGYLNN
PEKTQEAFRGDWYLTGDVASKDQDGYFWFIGRKDDVTKVSGYRIGPFEVESVLLEHPAIL
ESAVVADEDPIRGHVLHAYIVLKPGYTPSEELKKEIIEFVKSRYSKTVHLERVDFIDKLP
KTESGKIQRYLLKKKIS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtaagttattatgaggttgtaagaagttttagctggaaggagatcgaaaaaacaata
gatatttcatcactagtagaccatgagggggtagctgtaattagatttagtaaagaagga
aaagaacaaattactttccaagaacttaaagataaagcgttaaggcttgcttcttatctg
aagcatatagctggtgttaagaagggagatgtaatatcagttttagcttctaagaaaatt
gagcaagttatagtcctcttagccagtctctatataggagctttgtatcagcccttattt
acagcctttggacctaaggctatagaaattaggactagagataaaaaacctaaagtgtta
ttttatcaagatgatcaaaaagagaaggtaagtgaaggagtaccactttcaaagcttgat
gagttaacatcttacgggagattagaagagatagaaaggctaagctggaacgatccaatt
attttactttatacttctgggagtactggtttacctaaaggagcattaatatctaagagg
cttttacttaacacatacgtatatatgaaatacggaattgggttaagagagaatgatatt
ttctggaatggtgctgatcctggctgggcatatggtctctattatggaattataggccca
ttgcttttcggcaagactgtaatattcctagatgagcctttcgatgcagaaagaacaatg
gagtttcttgaagaaaacaaaataacaaatttcgcatgggcacctactacatataggatt
atatcgaggtctgtgaaaaggaagtacgatttaaggcttgaaagagctagctctgcagga
gaaccccttaatccagaggtaataaagtggtttaaagataattataatgtgattgtgaaa
gaccattatggtcagactgaagtagggatggtagtgtataatggttggggttatgattat
gagttaaagataggtagtatggggttaccagcaccaggttatgaggtggatattatagaa
gagaatatagctgtaaagaagacttctccaggatttcattttctaggatatttgaataat
cctgagaaaacgcaagaagctttcagaggagattggtatttaactggtgatgtagcatct
aaagatcaagacggatacttctggtttattggtagaaaggatgatgtaactaaggtgtct
ggatataggattggaccttttgaagtagagagtgtgctattagagcatccagctatcctt
gaatctgcagtagttgctgatgaagatcctattagggggcacgttctccacgcatatata
gttcttaaacccggatatactccaagtgaagagctaaaaaaggagataatagagtttgtt
aagagtcgttactctaagactgtgcatttagagagggtggatttcatcgataaattaccg
aaaaccgaaagtggaaaaatacaaaggtatttacttaagaaaaagataagttaa

DBGET integrated database retrieval system