KEGG   Sulfolobus tokodaii: ST1190Help
Entry
ST1190            CDS       T00062                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST1190
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST1190
   00620 Pyruvate metabolism
    ST1190
   00640 Propanoate metabolism
    ST1190
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST1190
   00680 Methane metabolism
    ST1190
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST1190
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192241..1193734
Genome map
AA seq 497 aa AA seqDB search
MVSYYEVVRSFSWKEIEKTIDISSLVDHEGVAVIRFSKEGKEQITFQELKDKALRLASYL
KHIAGVKKGDVISVLASKKIEQVIVLLASLYIGALYQPLFTAFGPKAIEIRTRDKKPKVL
FYQDDQKEKVSEGVPLSKLDELTSYGRLEEIERLSWNDPIILLYTSGSTGLPKGALISKR
LLLNTYVYMKYGIGLRENDIFWNGADPGWAYGLYYGIIGPLLFGKTVIFLDEPFDAERTM
EFLEENKITNFAWAPTTYRIISRSVKRKYDLRLERASSAGEPLNPEVIKWFKDNYNVIVK
DHYGQTEVGMVVYNGWGYDYELKIGSMGLPAPGYEVDIIEENIAVKKTSPGFHFLGYLNN
PEKTQEAFRGDWYLTGDVASKDQDGYFWFIGRKDDVTKVSGYRIGPFEVESVLLEHPAIL
ESAVVADEDPIRGHVLHAYIVLKPGYTPSEELKKEIIEFVKSRYSKTVHLERVDFIDKLP
KTESGKIQRYLLKKKIS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggtaagttattatgaggttgtaagaagttttagctggaaggagatcgaaaaaacaata
gatatttcatcactagtagaccatgagggggtagctgtaattagatttagtaaagaagga
aaagaacaaattactttccaagaacttaaagataaagcgttaaggcttgcttcttatctg
aagcatatagctggtgttaagaagggagatgtaatatcagttttagcttctaagaaaatt
gagcaagttatagtcctcttagccagtctctatataggagctttgtatcagcccttattt
acagcctttggacctaaggctatagaaattaggactagagataaaaaacctaaagtgtta
ttttatcaagatgatcaaaaagagaaggtaagtgaaggagtaccactttcaaagcttgat
gagttaacatcttacgggagattagaagagatagaaaggctaagctggaacgatccaatt
attttactttatacttctgggagtactggtttacctaaaggagcattaatatctaagagg
cttttacttaacacatacgtatatatgaaatacggaattgggttaagagagaatgatatt
ttctggaatggtgctgatcctggctgggcatatggtctctattatggaattataggccca
ttgcttttcggcaagactgtaatattcctagatgagcctttcgatgcagaaagaacaatg
gagtttcttgaagaaaacaaaataacaaatttcgcatgggcacctactacatataggatt
atatcgaggtctgtgaaaaggaagtacgatttaaggcttgaaagagctagctctgcagga
gaaccccttaatccagaggtaataaagtggtttaaagataattataatgtgattgtgaaa
gaccattatggtcagactgaagtagggatggtagtgtataatggttggggttatgattat
gagttaaagataggtagtatggggttaccagcaccaggttatgaggtggatattatagaa
gagaatatagctgtaaagaagacttctccaggatttcattttctaggatatttgaataat
cctgagaaaacgcaagaagctttcagaggagattggtatttaactggtgatgtagcatct
aaagatcaagacggatacttctggtttattggtagaaaggatgatgtaactaaggtgtct
ggatataggattggaccttttgaagtagagagtgtgctattagagcatccagctatcctt
gaatctgcagtagttgctgatgaagatcctattagggggcacgttctccacgcatatata
gttcttaaacccggatatactccaagtgaagagctaaaaaaggagataatagagtttgtt
aagagtcgttactctaagactgtgcatttagagagggtggatttcatcgataaattaccg
aaaaccgaaagtggaaaaatacaaaggtatttacttaagaaaaagataagttaa

DBGET integrated database retrieval system