KEGG   Sulfolobus tokodaii: ST1240Help
Entry
ST1240            CDS       T00062                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST1240
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ST1240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ST1240
Enzymes [BR:sto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ST1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241780..1242967
Genome map
AA seq 395 aa AA seqDB search
MQGYLKCLDCGSEYPIQQDIITCPKCGGLLEIIVEPKKDFSFSKLKGKGVWRYRELIAGE
YKHIVSLNEGNTPLIASSTNKNLYFKFEGANPTGSFKDRGMTVAISSAKSLNYKVVVAAS
TGNTAASAAAYASRAGLRSYIVLPKGKVALGKLAQSILYGTTILEVDGSFDVAMNSVMKL
YRELKIVYPLNSFNPWRLEGQKTIAFEIVEDIGVPDNVIVPVGNAGNIYAIWKGFVELMN
IGVTDKVPRMIGIQAEGAAPIAKALEKGLDKPEFIDSPETVASAIRIGKPVNWKKAIKAI
KSSNGFATYVSDSEILEAQKELARREGIGAEPASAASYAGYLKLVNSGKIDKSEKTVLIL
TGHALKDPDAMIKAESRRILVNPEHINEIILSDLK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggctatctaaaatgcttagactgtggatcagaatatcctatccaacaagatatt
ataacttgtcctaaatgtggaggattattagagataattgttgaacctaagaaagacttc
tcattcagtaaactaaaagggaaaggagtttggagatatagagaattaatagctggagaa
tacaaacatatagttagtttaaatgaaggaaataccccactaattgcttcttctactaat
aaaaatctatattttaagtttgaaggagccaaccctactggaagttttaaagatagagga
atgacagtagctataagttccgctaaatcattaaactataaagttgtagtagctgcatct
actggaaatactgcagcttcagccgctgcatatgcaagtagagctggtttaagaagttac
attgtattacctaaaggaaaagttgctttaggaaaattggctcaatctatactttatggg
actactatacttgaagttgatggcagttttgatgttgctatgaatagtgtaatgaaatta
tatagagaactaaaaatagtttatccgcttaactcttttaatccatggagacttgaagga
caaaaaactattgcttttgaaatagttgaggatattggagtacctgataatgtgatagta
cccgtaggtaatgccggaaacatttatgctatatggaagggatttgtagagttaatgaat
attggggttaccgataaagtacctagaatgattgggatacaagctgaaggagcagcgcca
atagctaaggctctagaaaaaggattagataaaccggaatttatagattcacctgaaact
gtagcctctgctataagaataggtaaaccagtgaactggaaaaaagcaattaaggctata
aaatcatctaatggatttgcaacttatgtttctgactctgagatcttagaggcgcaaaaa
gaattagctaggagagagggaataggtgcagaacctgcatcagctgcttcctatgctggt
tatttaaagcttgtaaattctggcaaaattgataaaagcgaaaaaactgttttaatttta
actgggcatgcgctaaaggacccagatgcgatgataaaagctgaatcacgaagaatttta
gttaacccagaacatataaatgaaataatcttgagtgatctaaaatga

DBGET integrated database retrieval system