KEGG   Sulfolobus tokodaii: ST1529Help
Entry
ST1529            CDS       T00062                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sto  Sulfolobus tokodaii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ST1529
  Amino acid metabolism
   00300 Lysine biosynthesis
    ST1529
Enzymes [BR:sto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ST1529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1521606..1522754
Genome map
AA seq 382 aa AA seqDB search
MEIEELTSKLIQFPTVNPPAENLHDCASFIKDYLSSQGFSSQVIEFEKGWPVVISENGNK
NDKLIMLNGHYDVVPTGDVNKWKYNPFSGKIIDDKVYGRGSTDMKGGLAVFMKVFTEIAD
KVNYNLIFTAVPDEESGGDKGSKYLADRYKPDLVLISEPSGSDSINIGEKGLLQVKLIAK
GKVAHGSLPSLGENAIMKLVKDLIQLEKIKEIEIKIPDNLIEAMTARIPSEIAKNDVLRI
SFNPGVIKGGVKVNVVPDYAEVEVDMRIPPGINSGEALNIVRSLVKQGEIIPLDISEPNY
TPPDNEFVKKLENIIYKQLGIKAKKYIITGATDGRYFRYKGVPVIVYGPGELGMAHAYDE
FISFKELRNSYTVIKDYLLTLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagaggaattaacctcaaaattaattcaatttcctacagtaaatccaccagct
gaaaacctacatgattgtgcctcatttataaaagattatctttcatctcagggtttttca
tctcaagttatagagtttgaaaagggctggccagttgttatttccgaaaatggcaataaa
aatgacaagctaataatgttaaacggccattatgatgttgtccctactggagatgttaat
aagtggaaatacaatcctttttctggaaagatcattgatgataaagtttacgggcgagga
agtactgatatgaaaggaggcttagccgttttcatgaaagtatttactgaaatagccgat
aaagttaattataaccttattttcacagctgttccagatgaagaaagtggtggtgataaa
gggtcaaaatatttagctgatagatataagccagatttagtactcatatctgaaccatcc
ggttcagattctataaacattggtgaaaaagggctattgcaagtaaagttaatcgctaaa
ggtaaggttgctcatggaagtcttccatctttaggtgaaaatgcaataatgaaactcgtt
aaggatttaattcaacttgaaaaaataaaagagattgaaataaaaatcccagataatctc
atagaagcgatgacagcaagaataccttccgaaattgctaagaatgatgtattgaggatt
tcctttaatcccggtgtaattaaaggcggagttaaggttaatgtagttccagattacgct
gaagttgaagttgatatgagaatacctcctggaataaatagtggtgaagcattaaatatt
gtaaggagtcttgtgaaacaaggtgaaataatacctctagatatctcagagcctaattat
actcctccagataatgagtttgtgaaaaaattggaaaatattatatataaacagctagga
attaaagctaagaaatatattattactggtgctacagatggtagatattttagatataaa
ggagttccagtaatagtttacggtccaggagagctaggtatggctcacgcttatgacgag
tttatttcatttaaagaattaagaaattcctatactgttataaaagattatttattaacc
ctcttctag

DBGET integrated database retrieval system