KEGG   Sulfolobus tokodaii: ST1531Help
Entry
ST1531            CDS       T00062                                 

Definition
pyruvate ferredoxin oxidoreductase
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sto01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sto00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sto00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sto00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sto00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sto00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sto00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sto00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sto00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1524122..1524667
Genome map
AA seq 181 aa AA seqDB search
MLIEIALRGRGGQGVVTAGELMVKATVLEDKYAQSIPFYGGERRGAPVVSFLRLSDKPVL
LHREVYNPDGVAVFDPSLTKIMDVTQGIKEDGFLLINTSEAKKIWKNEYIVDATSIAKDL
GLVIAGWAVVNTTMIGALAKILGMPSLTSLEEAIKEEFPGKLGELNAEAVERGYKEVKKV
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgaaatagccttaagaggtagaggagggcaaggagtagttaccgcgggagaa
ttaatggttaaagcgacagttcttgaggataagtatgctcagtcaattcccttttatgga
ggagaaagaagaggagctccggttgtatcatttttacgtctctcggacaaacctgttctt
ttacatagggaagtatataacccggatggagtagcagtttttgatccttccttaactaaa
attatggatgtaacacaaggcataaaagaagacggtttcttattaattaacacatcagaa
gcaaagaaaatttggaaaaatgagtatattgtggatgcaacatcaattgctaaagattta
ggcttagtaatagctggatgggcagtagtcaatactacaatgattggcgctttagctaaa
attttaggaatgccttctttaacttccttagaggaagcgataaaagaagaatttcctgga
aagcttggcgaattaaacgcagaagctgttgaaagagggtataaagaggtgaaaaaagtt
gattaa

DBGET integrated database retrieval system