KEGG   Sulfolobus tokodaii: ST1533Help
Entry
ST1533            CDS       T00062                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit beta (EC:1.2.7.7)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST1533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST1533
   00020 Citrate cycle (TCA cycle)
    ST1533
   00620 Pyruvate metabolism
    ST1533
   00640 Propanoate metabolism
    ST1533
   00650 Butanoate metabolism
    ST1533
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST1533
   00680 Methane metabolism
    ST1533
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ST1533
Enzymes [BR:sto01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ST1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1526077..1526979
Genome map
AA seq 300 aa AA seqDB search
MVVMSLITQVKRIPKFYRGNAACPGCPIPRELDILIEELGEKTVLVVPASCSTVILGDTS
GMPSTVPVVHSAFAASAAVASGIVRALRMRGDKDAIVTVWAGDGATGDIGFATLSGAAER
NEDILYVCYDNEAYMNTGIQRSGLTPKGAWTTTTPEGKREFKKPLPFIMAEHKIPYVATA
SIAYPFDYQAKVRKAKQIHGFRYIHLLSPCPPGWRFDSSLTIEIAKLAVETGVWPLFEIE
NGEFRLTSVSKTLLDKKNRKPVIEYLKLQGRFSKLTEEQIKEIQESIDEMWEQIKEMVKK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggttgttatgagtttaatcactcaagttaaaagaattccaaaattctatagaggaaat
gctgcatgtccaggttgtccaattccaagggaattagatatactaattgaggaattagga
gagaaaactgtactagttgttccagcatcatgctcaacagtaattttaggagatacttct
gggatgccatctacagttccagtagttcatagtgcatttgccgcatccgcagctgtagct
tctggtattgttagggctttaagaatgagaggagataaagatgcaatagttacagtatgg
gctggtgatggtgccactggagatataggttttgctactttaagtggtgctgctgaaaga
aatgaagacatactttacgtttgttatgataatgaagcctatatgaatactggaattcaa
cgttcaggtttaactcctaaaggagcctggacaactacaactccagaaggtaaaagagag
ttcaaaaaaccactaccattcattatggctgaacataaaataccttacgtagctactgca
tcaatagcttatccatttgattatcaagcaaaggtgaggaaagcaaagcaaattcacgga
tttaggtacatacatttactatcaccatgtccaccaggctggcgttttgactcaagttta
acaattgaaattgcaaagttagctgtagaaaccggtgtttggccattatttgaaatagag
aacggagaatttagattaacaagtgttagtaagacactacttgataagaaaaacagaaaa
ccagtgatagaatacttaaaattgcagggaagatttagtaaacttactgaggaacaaatt
aaagaaattcaagaatcaatagacgaaatgtgggaacaaattaaagaaatggttaaaaaa
tga

DBGET integrated database retrieval system