KEGG   Sulfolobus tokodaii: ST1567Help
Entry
ST1567            CDS       T00062                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sto01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sto00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sto00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1562905..1564200)
Genome map
AA seq 431 aa AA seqDB search
MLEKVRFDLPQDEIPTEWYNILPDLPEPLPEPQDPTGKSFEILKQVLPSKVLELEFSKER
YIKIPEEVLQRYLQVGRPTPIIRARKLEEYLGGYIKIYMKMESHTYTGSHKINSALAHVY
FAKLDNAKFVSTETGAGQWGSAVALASALFNIQAHIFMVRTSYYAKPYRRYLMQMYNAQV
HPSPSEFTRYGREVLAKDPNTPGSLGIAISEAVYYALENGGKYVVGSVVNSDILFKTIAG
MEAKKQMEMIGEDPDYIIGVVGGGSNYAALAYPFLGEELRKGKVRRKYIASGAIEVPKMT
KGVYKYDYPDTAKILPMLKMYTIGSDFIPAPVYAGGLRYHAVAPTLSLLMYKGIVQARDY
SQEEAFSWAKLFSQIEGWVPAPETSHALPILKEIVEEAKKSGEKKTVLISFSGHGLLDLA
NYADVLGFNKE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaaaaagttagattcgacttaccgcaagatgagataccaacagagtggtataac
attttaccagatctaccggaaccattaccagaaccccaggatcctactggaaaatcattt
gaaatattaaaacaagtattaccaagtaaagttcttgaactcgaattctcaaaagagaga
tatataaagataccggaagaggttcttcaacgatatttacaagttggaagaccaacacca
ataataagggctagaaaactggaggaatacctaggaggatatataaagatatatatgaaa
atggaaagtcacacttatactggttcacacaagataaatagtgcattagctcacgtatat
tttgcaaaacttgataatgctaaattcgtttcaactgaaactggtgcagggcaatgggga
tctgcagtagcgttagcttctgcattatttaatattcaagctcacattttcatggtcaga
actagttactacgcaaaaccctatagaaggtatctaatgcaaatgtataatgcacaagta
catccaagtccttcagaattcaccagatacggaagagaagttttagctaaagatcccaac
acaccggggtcattaggaattgctatatcagaggctgtctattacgccctagaaaatgga
ggaaaatacgttgtaggtagtgtggtaaactcagacattctctttaaaacaattgccgga
atggaggcaaagaagcaaatggaaatgattggtgaagacccagattatattataggagtt
gttggcggaggttcaaattacgctgctttagcttatccattcttaggtgaagaattaaga
aaaggtaaagtaagaagaaagtacatagcatctggagcaatagaagtaccaaaaatgaca
aaaggagtttataaatacgattatccagatacagcaaagattttgccaatgctaaagatg
tatactattggatctgacttcataccagcaccagtttatgctggaggcttaagatatcat
gcagtagcaccaacattatcgttattaatgtacaaagggattgtacaagctagggattat
tcacaagaagaagcattttcgtgggctaaattgtttagtcaaattgaaggatgggtaccg
gcaccagaaactagtcatgcattaccaatcttaaaagaaatagttgaggaagctaagaag
agtggcgaaaagaaaacagtactaataagcttctcaggccatggattattggatctagct
aactacgctgatgtgttaggttttaataaggaataa

DBGET integrated database retrieval system