KEGG   Sulfolobus tokodaii: ST1788Help
Entry
ST1788            CDS       T00062                                 

Definition
2-ketovalerate ferredoxin oxidoreductase subunit alpha
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sto01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sto00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sto00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sto00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sto00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sto00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sto00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sto00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sto00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1805175..1806371)
Genome map
AA seq 398 aa AA seqDB search
MKMISKVISGNEAVALGVKLSRVKVIAIYPITPQTYIIEELAAMRDKGELDAEVIRVESE
HSAMAAVYGAASAGVRVYTATASQGLLYMHEMIWWVAGSRIPIVMTVGTRAVGAPWNIWN
EHTDFMSERDSGWLMAFASTPQEALDLTIQAFKISEDEKVFLPMMVGMDGFILSHTKTRV
YIPSQEEVDSFLPPRKQPYVLDPEDPVDIGNMFQPIDYMKFRHSMHLAMLNSKEVIKEIG
KEYEKKVVPVGSYSSLNESYKLDDAEYALVSMGAWSLDAMQVVDELRNMGVKIGLYRIRY
VRPWDEEDIKRKLGDKDGILVLDRSVSFGRGGHLYLELKATLPDVNIKGVVTGLGGVAIN
KDSISSLTKKFIEGKTDGEWFYPSEVEKVELRSPRYIK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgattagtaaagtaatttctgggaatgaagctgtagctttaggagttaaactg
tctagggtaaaagtgatagcaatctatccaataaccccacagacatatataatagaagaa
cttgctgctatgagagataaaggggaattagatgctgaagtaattagagttgagagcgag
cattctgcaatggcagctgtttatggtgctgcatctgctggagtaagagtttatactgct
actgcatctcaaggactactttacatgcatgaaatgatttggtgggtcgctggtagtaga
atacctattgttatgactgtaggtaccagagccgttggagctccatggaatatttggaat
gagcatacggattttatgagcgagagagatagtggttggcttatggcatttgcatcaact
cctcaagaagctttggatctaacaattcaagcctttaaaatatctgaagatgaaaaggtt
ttcttgccaatgatggtaggaatggacggatttattctttcccacactaagaccagagtt
tatattcctagtcaggaagaagttgattcgttcttacccccaaggaaacagccttatgtt
ttagatccagaagatcctgttgatattggaaatatgtttcaaccaattgattacatgaag
tttaggcattcgatgcatctagctatgttaaactctaaggaggtaatcaaagagattgga
aaggaatatgagaaaaaagtagtaccagtaggttcatattcttctttaaacgaatcttat
aaactcgatgatgcggaatatgctctagtatccatgggtgcgtggtctttagatgctatg
caagttgtagatgaattaagaaatatgggagtgaaaataggtctctataggatcagatat
gttagaccttgggatgaagaagatattaaaagaaaattaggagataaagatggaatctta
gtgcttgataggtcagtgagctttggtagaggagggcatttatacctagagttaaaagca
actttaccagatgttaatataaaaggagtagttactggtttaggcggagtagctattaat
aaggattcaatttcttccctaacgaaaaagtttattgaaggtaagacagacggcgaatgg
ttttatccgagtgaggtggaaaaagttgagcttaggagtccgagatatattaaataa

DBGET integrated database retrieval system