KEGG   Sulfolobus tokodaii: ST2017Help
Entry
ST2017            CDS       T00062                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sto  Sulfolobus tokodaii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ST2017
Enzymes [BR:sto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ST2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2033797..2035596)
Genome map
AA seq 599 aa AA seqDB search
MVRYVIIGNGSLTLLADSKLNYRELYYPLPIDNHLHESKIGLWVDGKFSWFSDLPIKLNY
EEDTLSVTASAEFNGVKVKVKDAVDMAYDILVREISLTTNKETRVFFHWDFHINGNDIGD
TALYDPFTSSIIHYKRDKWFMFKCDIPFYQFATGYKETGGYLGTWKDAEDGELSGNPIAQ
GSVDSVTSIRVSSNTVFYCWLVCGRNYNELFQKNNYVLRKSSRELLRRTENYWKAWLVKA
RDYDSLVRRSLLIIAAHWQNNGALPAALDTDIMRFNKDTYNYVWHRDAAFASIALTLYGY
QDPIRNLFNFTKPLIFNGFLFQKYTCDGNWGSTWHPWNPRSIPIQEDETALMLYALWVHF
SRFTDIDFVRPLYAPFVKKIAEFLVSYRDEETGLPLPSYDLWEERLGTHFFTSLAVYAGL
MSAYKFAEFFGDENLKDKYLTAANEVKKGLERFYVGDHFARTIYEDNSIDKTVDASTLFA
SILGPFDPKDPRVISNRKVVEEKLNINGGIARYENDWYLKQDEKSNAWFITTLWLAQQYI
LEGNKEKAKKYIDWVISHMLPTGIIPEQVSPKNTYPSVAPLVWSHAEFVKTIYYFKQLG
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggttagatatgttataataggcaatggctcacttacattattagccgattctaaatta
aattatagagaattatattatccactccctatagataatcatcttcatgaaagtaaaatt
ggtctatgggtagatggaaaattctcatggttttctgatttaccaataaaattaaattat
gaagaagatactctttctgttacggcatcagctgaatttaacggagtaaaagtcaaggta
aaagatgccgtagatatggcttatgatattttagttagagaaattagcttaactactaat
aaggagaccagagtatttttccattgggattttcatataaatggaaatgatataggtgat
acagccttatatgacccattcacatcttctattatccattacaaaagagataaatggttc
atgtttaagtgtgatattccattctatcaatttgctactggctataaggaaactggagga
tatttaggtacatggaaagatgcagaagatggagaactttccggaaatccaatagcacaa
ggatcagtggattcggttacaagtataagagtatcttcaaatacagtattctattgctgg
ctagtatgtggtaggaattataatgaattgttccaaaagaataactatgttttgagaaaa
agttctagagaattattgagaaggacagaaaattactggaaggcatggttagttaaagcc
agagattatgatagtttagtcagacgaagtttactaattattgcagctcactggcaaaat
aatggcgcacttccagcagccttagacactgacattatgagatttaacaaagatacatac
aattatgtttggcatagagatgcagctttcgcatcgatagcgttaacactttatggctat
caagatcctataagaaatctttttaattttactaaacccttaatttttaatggttttctc
tttcagaagtatacttgcgatggcaattggggttctacctggcatccgtggaatccaaga
agcataccaatacaagaagacgaaacagcattaatgctttatgccttatgggttcatttt
agtagatttactgatatagattttgtaagaccgctttatgctcccttcgtaaagaaaatt
gctgaattcttagtctcttatagagatgaagaaaccggtttacctttaccctcatatgat
ttatgggaagaaaggcttggtacacacttctttacttctttagcagtatatgctggatta
atgtcggcttataagtttgctgaattttttggtgatgaaaacttaaaggacaaatacctc
acagctgctaatgaagtgaaaaaaggattagaaagattttatgttggtgatcattttgct
aggactatttatgaagataatagtattgacaaaactgtagatgctagtacattatttgcc
tcaattttaggaccttttgaccctaaagacccaagggttataagcaataggaaagttgta
gaggagaaacttaatataaatggcggaattgccagatatgaaaatgattggtatttaaaa
caagacgaaaaatctaacgcttggtttattacgacactatggttagctcagcaatacatt
cttgaaggcaataaagaaaaagctaaaaaatatatagattgggttatatcacatatgcta
ccaacgggtatcattccagaacaagtaagtcctaaaaatacatatccatcagttgcccca
ttagtttggagtcatgcagaattcgttaaaaccatttattattttaagcagttaggataa

DBGET integrated database retrieval system