KEGG   Sulfolobus tokodaii: ST2019Help
Entry
ST2019            CDS       T00062                                 

Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST2019
   00620 Pyruvate metabolism
    ST2019
   00640 Propanoate metabolism
    ST2019
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST2019
   00680 Methane metabolism
    ST2019
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST2019
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036189..2038174
Genome map
AA seq 661 aa AA seqDB search
MSVNWSLPFEEKIIPSKYQSKVISPSIYKELHKIATENYKEFWASIASQLEWFKPWEKVL
DDSNPPFYKWFVSGEINASYLAVDRHAKSWRKNKVAIIWEGEPAEGDKPKEVRYITYGEL
YREVNRVAYILKEVYGLKKGDAISLYLPMIPELPIFMLAAARLGIIFSVVFSGFSAQALA
DRINDARAKLLVTADGGWRRGKIVPLKDIADKALENTSTVEKVLVVKRTNNNITMKEGRD
EFFDNVYKQVPLNAYVEPERTKSEDPLFILYTSGTTGKPKGIVHDTGGYLTILHATMNWV
FDIKDSDIMWTTADIGWITGHSYIVFGPLLEGVTTVMYEGALDYPNPDRWASIIERYGVT
ILYTSPTAIRSFMKLGEDVYKGRDFSSVRLMHSVGEPINPEAFRWFFRLVGKESIPFGST
WWMTETGGIMISHLPGLYLIPLKPGTNGMPLPGIDADVVNENGNPTKPEERGYLVIRKPW
PGMPLTIWGDPDRYVKVYWSKFPGIFYPGDFAVKDSDGYFWILGRADEVIKVAGHRLGTY
ELESALIHHPAVAEAAVVGVPDPLKGEVPVAFVVLKVGQKANEELKKSLNEWVREQVGPI
ASLSSIYFVSKLPKTRSGKIMRRVVKAVITNQPVGDVTTLEDEASVEEVKKAYEELKKEI
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaactggtctcttccatttgaagagaaaataataccaagtaagtatcagagc
aaagtaatttcaccatcaatatataaagagttacacaagatagctactgaaaattacaag
gagttttgggcatcaattgcctctcaattagagtggtttaagccttgggaaaaggtactt
gatgattctaatccaccattttacaagtggtttgttagtggtgaaataaatgcttcatat
ttagctgtggatagacatgctaagagttggagaaaaaataaagtagcaataatttgggaa
ggagaaccggcagaaggtgataagccaaaggaggtaagatatattacatatggtgaatta
tatagagaagtaaatagagtggcttatattcttaaggaagtttatgggttaaagaagggt
gatgctatatcattatatttaccaatgatacccgaattacctatatttatgttagccgct
gctagattggggataatatttagtgtagtgttttctggatttagtgcccaagcattagca
gatagaattaatgatgctagagctaaattattagtaacggctgatggaggttggagaaga
ggtaaaatagttccactaaaagatatagcagataaggcattagaaaatacatctactgta
gagaaagtcttggttgtaaaaagaacgaataataatataactatgaaagaaggtagagat
gaatttttcgataatgtatataagcaagttcctttgaatgcatatgtagagccagagaga
acaaagagcgaagatcctctattcattctctatacctctggaaccactggcaagccaaag
ggaatagttcatgatactggcggatatttaactattcttcacgctacaatgaactgggta
ttcgatattaaagatagtgatataatgtggactactgctgatattggttggattactggt
cattcatatatagtatttggtcctctattagaaggagtaacaacagtaatgtatgaagga
gctctagattatccaaacccagataggtgggcatctataattgagagatatggtgttacg
atactttatacttcacctacagcaataaggtctttcatgaaattaggagaggatgtatat
aaaggtagagatttctcttctgtgagattaatgcattctgtaggagagccaataaaccca
gaggcatttagatggttcttcagattggtaggaaaagaaagcataccatttggtagtact
tggtggatgactgagactggtggtattatgattagtcacttacccggtctttatctaatt
ccattgaaaccaggaactaatggaatgccgttaccgggaattgatgcagatgttgttaat
gaaaatggtaatcctacaaaacctgaagaaagaggatatctagtgattagaaaaccatgg
cctggaatgccattaactatttggggagatccagatagatatgttaaagtatactggtct
aaattcccgggtatattttatcccggcgatttcgctgttaaagattctgatggatacttc
tggatattaggtagggctgacgaggtaattaaagtagctgggcatagattaggaacatat
gagttagagtctgctttaatacatcacccagccgttgctgaagcagcagttgtaggagtc
ccagatccattaaaaggtgaagtaccggtagcatttgtagtattaaaggtgggacaaaaa
gcaaatgaggagttgaaaaagagcttaaatgaatgggtaagagagcaagtaggacctata
gcgtcattaagtagtatttactttgtatctaaacttccaaaaactaggagtggtaagatt
atgagaagagtagtaaaggctgttattactaatcagccagtaggcgatgtcacaacactt
gaagatgaagcttcggtagaagaagttaaaaaggcatacgaagaattaaagaaggagata
tcctaa

DBGET integrated database retrieval system