KEGG   Sulfolobus tokodaii: ST2019Help
Entry
ST2019            CDS       T00062                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2019
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST2019
   00620 Pyruvate metabolism
    ST2019
   00640 Propanoate metabolism
    ST2019
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST2019
   00680 Methane metabolism
    ST2019
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST2019
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036189..2038174
Genome map
AA seq 661 aa AA seqDB search
MSVNWSLPFEEKIIPSKYQSKVISPSIYKELHKIATENYKEFWASIASQLEWFKPWEKVL
DDSNPPFYKWFVSGEINASYLAVDRHAKSWRKNKVAIIWEGEPAEGDKPKEVRYITYGEL
YREVNRVAYILKEVYGLKKGDAISLYLPMIPELPIFMLAAARLGIIFSVVFSGFSAQALA
DRINDARAKLLVTADGGWRRGKIVPLKDIADKALENTSTVEKVLVVKRTNNNITMKEGRD
EFFDNVYKQVPLNAYVEPERTKSEDPLFILYTSGTTGKPKGIVHDTGGYLTILHATMNWV
FDIKDSDIMWTTADIGWITGHSYIVFGPLLEGVTTVMYEGALDYPNPDRWASIIERYGVT
ILYTSPTAIRSFMKLGEDVYKGRDFSSVRLMHSVGEPINPEAFRWFFRLVGKESIPFGST
WWMTETGGIMISHLPGLYLIPLKPGTNGMPLPGIDADVVNENGNPTKPEERGYLVIRKPW
PGMPLTIWGDPDRYVKVYWSKFPGIFYPGDFAVKDSDGYFWILGRADEVIKVAGHRLGTY
ELESALIHHPAVAEAAVVGVPDPLKGEVPVAFVVLKVGQKANEELKKSLNEWVREQVGPI
ASLSSIYFVSKLPKTRSGKIMRRVVKAVITNQPVGDVTTLEDEASVEEVKKAYEELKKEI
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaactggtctcttccatttgaagagaaaataataccaagtaagtatcagagc
aaagtaatttcaccatcaatatataaagagttacacaagatagctactgaaaattacaag
gagttttgggcatcaattgcctctcaattagagtggtttaagccttgggaaaaggtactt
gatgattctaatccaccattttacaagtggtttgttagtggtgaaataaatgcttcatat
ttagctgtggatagacatgctaagagttggagaaaaaataaagtagcaataatttgggaa
ggagaaccggcagaaggtgataagccaaaggaggtaagatatattacatatggtgaatta
tatagagaagtaaatagagtggcttatattcttaaggaagtttatgggttaaagaagggt
gatgctatatcattatatttaccaatgatacccgaattacctatatttatgttagccgct
gctagattggggataatatttagtgtagtgttttctggatttagtgcccaagcattagca
gatagaattaatgatgctagagctaaattattagtaacggctgatggaggttggagaaga
ggtaaaatagttccactaaaagatatagcagataaggcattagaaaatacatctactgta
gagaaagtcttggttgtaaaaagaacgaataataatataactatgaaagaaggtagagat
gaatttttcgataatgtatataagcaagttcctttgaatgcatatgtagagccagagaga
acaaagagcgaagatcctctattcattctctatacctctggaaccactggcaagccaaag
ggaatagttcatgatactggcggatatttaactattcttcacgctacaatgaactgggta
ttcgatattaaagatagtgatataatgtggactactgctgatattggttggattactggt
cattcatatatagtatttggtcctctattagaaggagtaacaacagtaatgtatgaagga
gctctagattatccaaacccagataggtgggcatctataattgagagatatggtgttacg
atactttatacttcacctacagcaataaggtctttcatgaaattaggagaggatgtatat
aaaggtagagatttctcttctgtgagattaatgcattctgtaggagagccaataaaccca
gaggcatttagatggttcttcagattggtaggaaaagaaagcataccatttggtagtact
tggtggatgactgagactggtggtattatgattagtcacttacccggtctttatctaatt
ccattgaaaccaggaactaatggaatgccgttaccgggaattgatgcagatgttgttaat
gaaaatggtaatcctacaaaacctgaagaaagaggatatctagtgattagaaaaccatgg
cctggaatgccattaactatttggggagatccagatagatatgttaaagtatactggtct
aaattcccgggtatattttatcccggcgatttcgctgttaaagattctgatggatacttc
tggatattaggtagggctgacgaggtaattaaagtagctgggcatagattaggaacatat
gagttagagtctgctttaatacatcacccagccgttgctgaagcagcagttgtaggagtc
ccagatccattaaaaggtgaagtaccggtagcatttgtagtattaaaggtgggacaaaaa
gcaaatgaggagttgaaaaagagcttaaatgaatgggtaagagagcaagtaggacctata
gcgtcattaagtagtatttactttgtatctaaacttccaaaaactaggagtggtaagatt
atgagaagagtagtaaaggctgttattactaatcagccagtaggcgatgtcacaacactt
gaagatgaagcttcggtagaagaagttaaaaaggcatacgaagaattaaagaaggagata
tcctaa

DBGET integrated database retrieval system