KEGG   Sulfolobus tokodaii: ST2030Help
Entry
ST2030            CDS       T00062                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2030
   01230 Biosynthesis of amino acids
    ST2030
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST2030
   00051 Fructose and mannose metabolism
    ST2030
   00562 Inositol phosphate metabolism
    ST2030
Enzymes [BR:sto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ST2030
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ST2030
  Exosomal proteins of bladder cancer cells
   ST2030
  Exosomal proteins of melanoma cells
   ST2030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2045425..2046114
Genome map
AA seq 229 aa AA seqDB search
MKPPIILINYKAYENSYGEKGVEISKKIEKVSKDYGVPIIISVPATMIYKLSQILEIPVY
AQHVDALRHGAHTGAILPEMIKDAGAKGSLLNHSERKIRLDEIHEAVTRIRDLGLESVVC
ADSYELVHPLALLKPNAILIEPPELIGSGRAVSKEKPEVITRAVNEIKKVEGVYLIAGAG
ITTGEDVYKAIELGADGIGVASAVMKSSTPEKIVEDFIINALKAIDRKK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccccctataatattaatcaactacaaggcatatgaaaattcctacggagaaaag
ggagtagaaatatctaaaaaaatagagaaagttagcaaggactacggggtaccaattatt
atatcagttccagcaacaatgatatacaaactctctcaaattttggaaataccagtatac
gcacaacatgttgatgcattaagacatggagcgcatactggtgcaatattaccagagatg
ataaaagatgctggagctaagggatcattacttaatcatagcgaaagaaaaattagatta
gatgaaatacatgaggctgttacaaggataagagatttaggattagagagtgttgtttgt
gctgactcttatgaattagttcatcctctagcattacttaaacctaacgctatacttata
gaacctccagaattaatcggaagtggaagagcagtatctaaagaaaaaccagaagttata
acaagagcagttaacgagataaaaaaggtagaaggagtttacctaatcgctggagctggg
attacaacaggtgaagatgtatataaagcaattgaattaggagctgatggtattggtgtt
gctagtgcagtaatgaaatcatcaacgccagaaaaaatagtagaagatttcattataaac
gctttaaaagctattgatagaaagaaataa

DBGET integrated database retrieval system