KEGG   Sulfolobus tokodaii: ST2139Help
Entry
ST2139            CDS       T00062                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2139
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ST2139
   00620 Pyruvate metabolism
    ST2139
   00640 Propanoate metabolism
    ST2139
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ST2139
   00680 Methane metabolism
    ST2139
Enzymes [BR:sto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ST2139
Lipid biosynthesis proteins [BR:sto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ST2139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2140210..2141940
Genome map
AA seq 576 aa AA seqDB search
MGYAKTSSRIDMDYFTLYQYSIENPEKYWSSFANKLEWFSKWNSVIIRDKYIAKWFVNGK
TNIAYNSVNTHQGKALIWYGEDGKRIEITYDELNRLSNSIANLLKKRGIKKGMRIAIYSP
NSILTLASILGTAKIGAIYTLIFAGLGIEAIKSRLNDFNPDLVISSRKTFRRGKEIPLLI
EGDINFERNDEDEIRKLLDSDEVKVEEIEANEPLKVMYTSGTTGKPKGVILPHGAWMVGD
YTVFDLLFGLKPGDKVLTTTDVGWITFSRIMYGTLLHGSTFIFMEGAPDYPKDRLVKIIE
EEQPKVLFTSPTLIRLLMKYDIKLPRVEYIATAGEIFDEKSWNYALEIADKVTDVYGQSE
LGYVVGIPYSLESIKPKIGYAGVPFPGIVLDTLDDEGKAVRNKPGYLVAKTPFPTQFIGI
LNNEKKFTEYFEKFGFHDTGDLAIFDGTYIKIVGRADDMIKVAGHRITSGEVESIIASID
GVKDVAVVGIPDEIRGEKLAIFVVGKVDKEEIKRKVLDALGPIYIIHDVYVVEKLPKSRS
GKTVRRILRDILLNKEIDASILEDPEVVKEIKDEIS
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgggttatgccaaaactagtagtagaatagatatggattatttcactctttatcaatat
tcaatagaaaacccagaaaaatattggagttcttttgctaataaattagaatggttttct
aagtggaatagtgttataataagggacaaatacatcgcaaaatggtttgttaatggtaaa
actaatatagcctataattccgtcaatacacatcaaggcaaggcactaatttggtatgga
gaagacggaaaaagaatagaaataacatatgatgaactaaataggctaagtaactctatt
gcaaacttacttaaaaagaggggaattaaaaaaggtatgaggattgctatttattcaccc
aattctatactaacattggcctcaattttaggaacagctaaaattggtgctatttatacc
cttatctttgctggactaggtattgaggctataaaatctaggcttaatgattttaatcca
gaccttgtcatatcatcaagaaagacctttaggagaggaaaagaaatacccctattaata
gaaggggatattaattttgaaagaaatgatgaagatgaaatccgcaaacttttagatagc
gatgaagtaaaagtggaagaaatagaagctaatgaaccattaaaagtgatgtacacttct
ggtactacgggtaagcctaaaggagtaattttgcctcatggtgcgtggatggtaggagat
tatacagtatttgatttactttttggactaaaacctggtgataaggtcctaactactaca
gatgtcggctggataactttctctagaataatgtatggtactttacttcatggttctact
tttatatttatggaaggagctccagattatcctaaagatagattagttaaaataattgaa
gaagagcaacccaaagtactattcacttctcccactttaataagattgttgatgaaatat
gatataaaacttccaagagtagaatatattgctactgcaggagagatatttgatgaaaaa
agctggaattatgcattagaaattgcagataaagttactgatgtatatggacaaagcgaa
ttgggctatgtagtaggaataccttattcactagagagcataaaaccgaagataggatat
gcaggtgtaccttttcctggtatagtcttagatacattggatgatgaggggaaggcagtg
agaaacaaacctggctatctagttgcaaaaactccttttccaactcaatttataggaata
ttaaataatgaaaagaaatttacagaatattttgagaaatttggtttccatgataccgga
gatttagcaatatttgatggaacttatataaagatagtaggaagagcagacgatatgatt
aaagttgcagggcatagaattacaagtggagaagttgaaagtataatagctagtattgat
ggagtgaaagatgtagcagtagtaggtattccagacgaaattagaggtgaaaagctggca
atctttgtagttggaaaagtagataaagaggaaattaaaagaaaagttcttgatgcatta
ggaccaatttatattattcatgatgtttatgtcgtagaaaagttacctaaatctagaagt
ggcaagactgtaagaagaattttaagagatatacttttaaataaggaaattgatgcttca
atacttgaagacccagaagtcgtaaaggagattaaggatgaaatttcatga

DBGET integrated database retrieval system