KEGG   Sulfolobus tokodaii: ST2186Help
Entry
ST2186            CDS       T00062                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sto  Sulfolobus tokodaii
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ST2186
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ST2186
Enzymes [BR:sto01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     ST2186
Peptidases [BR:sto01002]
 Cysteine Peptidases
  Family C44
   ST2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2185552..2187330
Genome map
AA seq 592 aa AA seqDB search
MSLVCGIIGIVSLRESKKLAEMTVSALKRLEYRGYDSVGVASISSNGLEIRKAKGKVEEV
VLQKKIEEMEGYVFLGHTRWATHGPPTDYNAHPHTDCNGNIAVVHNGTIKNYKELREELE
SLGHKFKSETDTEVIPHLIEEFMKRGMDPFQAFKSAIKSLEGSYAVLAVINGERRIFFAK
KDNPLIIGLGEGQNFIASDIPAFLPYTKRILVIRDDELGFITPETVYLEDKDGNVINIKE
RIRSVDWDIETASKEGYPHFMIKEIHESPRAVKETIDSLMSDIDLVEKVIEEIKNAERVI
VIGAGTSYHAGLYFSIELNRLGINSLPVIASEYYNVRSKKGDLVFAISQSGETIDVLQGI
RMMRNSGAKIISLTNVIESAIARESDYKIYMRAGPEIGVAATKTFTTQLASILFILSVLK
KENLKKMEKAPDIVRDTISQVEGLTKKIGEELAKKSNIYYLGRGLSLPLAMEGALKIKEI
AYVHAEAYPAGESKHGPISLVEKGFPVVIINDGELTELLQNNLMEMKARGARIYAVSVNK
KMKDADVEIELQSEIPVLSIAPVIQLIAYYAAVTKGYDPDKPRNLAKTVTVE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgtgtgcggaataattggtatagtatcactaagggaaagtaaaaaacttgct
gaaatgacagtttcagctttgaaaagacttgaatatagaggttatgatagtgttggtgtt
gcctcaataagctctaatggtttagaaattagaaaggcaaaaggaaaagtagaagaggtt
gttcttcagaagaagattgaggaaatggaaggatatgtgttcttaggccatactagatgg
gctactcatggtcctcctactgattataacgctcatcctcacactgactgtaatggtaat
atagctgtagtacataatgggactataaagaattataaagaattaagagaggaacttgag
agtttaggtcataaattcaagagtgaaactgatactgaagtcatcccccatttaattgag
gaatttatgaaacgaggaatggatccttttcaagcttttaagtcagcgataaaaagcctt
gaaggtagctatgcagtcttggctgttataaacggtgaaagaagaatattctttgctaaa
aaagataatccattaataataggattaggtgaagggcaaaattttattgcaagcgatatt
ccagctttcttaccttatactaaaagaatactagttatcagagatgacgagttaggtttt
ataacaccagaaactgtttatttagaagataaagacggtaatgtcatcaatataaaagaa
aggataagaagtgtagattgggatatagaaactgctagtaaagaaggatatcctcatttt
atgattaaggaaattcatgaatcaccaagggcagtaaaagagacaatagacagcctaatg
agtgacatagacttagtagagaaagttatagaagaaataaaaaatgctgagagagttata
gttataggagctggaacaagttatcatgctggtctttacttttcaatagaacttaacaga
cttggtataaactctctacccgtaatagcttctgagtactataatgtgaggagtaaaaaa
ggggacttagtttttgcgataagtcaaagcggtgaaacaatagatgtacttcaagggata
agaatgatgcgaaatagtggtgctaaaattatctctctaactaacgttatagaaagtgct
atagctagagaaagcgattataaaatctacatgagggcaggaccagaaattggtgtagcc
gcaacaaaaacttttacaacacaattagcttcaattctcttcatcctatccgttttaaag
aaggagaatctaaagaaaatggaaaaagctccagatatagtgagagatacaatatcacaa
gtagaaggattaacaaagaaaattggagaagaattagctaagaaaagtaatatatactac
ttgggtagaggactctcactaccactagcaatggaaggtgcattaaaaataaaagaaata
gcttatgtacatgccgaagcatatcctgctggtgaaagtaagcatgggccaatatctcta
gtagaaaaaggattcccagtagttataataaatgatggtgaattaacagaactcttacaa
aataatttaatggaaatgaaggctagaggggctagaatttatgcagtaagcgtgaataaa
aagatgaaagatgctgatgttgaaatagagcttcagtccgagatcccagtattatctata
gccccagtaatccaattaatagcatattatgctgcagtaactaaaggatatgacccagat
aaaccaagaaacttagctaaaacagttactgtagaataa

DBGET integrated database retrieval system