KEGG   Sulfolobus tokodaii: ST2186Help
Entry
ST2186            CDS       T00062                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
sto  Sulfolobus tokodaii
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sto00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sto00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2185552..2187330
Genome map
AA seq 592 aa AA seqDB search
MSLVCGIIGIVSLRESKKLAEMTVSALKRLEYRGYDSVGVASISSNGLEIRKAKGKVEEV
VLQKKIEEMEGYVFLGHTRWATHGPPTDYNAHPHTDCNGNIAVVHNGTIKNYKELREELE
SLGHKFKSETDTEVIPHLIEEFMKRGMDPFQAFKSAIKSLEGSYAVLAVINGERRIFFAK
KDNPLIIGLGEGQNFIASDIPAFLPYTKRILVIRDDELGFITPETVYLEDKDGNVINIKE
RIRSVDWDIETASKEGYPHFMIKEIHESPRAVKETIDSLMSDIDLVEKVIEEIKNAERVI
VIGAGTSYHAGLYFSIELNRLGINSLPVIASEYYNVRSKKGDLVFAISQSGETIDVLQGI
RMMRNSGAKIISLTNVIESAIARESDYKIYMRAGPEIGVAATKTFTTQLASILFILSVLK
KENLKKMEKAPDIVRDTISQVEGLTKKIGEELAKKSNIYYLGRGLSLPLAMEGALKIKEI
AYVHAEAYPAGESKHGPISLVEKGFPVVIINDGELTELLQNNLMEMKARGARIYAVSVNK
KMKDADVEIELQSEIPVLSIAPVIQLIAYYAAVTKGYDPDKPRNLAKTVTVE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgtgtgcggaataattggtatagtatcactaagggaaagtaaaaaacttgct
gaaatgacagtttcagctttgaaaagacttgaatatagaggttatgatagtgttggtgtt
gcctcaataagctctaatggtttagaaattagaaaggcaaaaggaaaagtagaagaggtt
gttcttcagaagaagattgaggaaatggaaggatatgtgttcttaggccatactagatgg
gctactcatggtcctcctactgattataacgctcatcctcacactgactgtaatggtaat
atagctgtagtacataatgggactataaagaattataaagaattaagagaggaacttgag
agtttaggtcataaattcaagagtgaaactgatactgaagtcatcccccatttaattgag
gaatttatgaaacgaggaatggatccttttcaagcttttaagtcagcgataaaaagcctt
gaaggtagctatgcagtcttggctgttataaacggtgaaagaagaatattctttgctaaa
aaagataatccattaataataggattaggtgaagggcaaaattttattgcaagcgatatt
ccagctttcttaccttatactaaaagaatactagttatcagagatgacgagttaggtttt
ataacaccagaaactgtttatttagaagataaagacggtaatgtcatcaatataaaagaa
aggataagaagtgtagattgggatatagaaactgctagtaaagaaggatatcctcatttt
atgattaaggaaattcatgaatcaccaagggcagtaaaagagacaatagacagcctaatg
agtgacatagacttagtagagaaagttatagaagaaataaaaaatgctgagagagttata
gttataggagctggaacaagttatcatgctggtctttacttttcaatagaacttaacaga
cttggtataaactctctacccgtaatagcttctgagtactataatgtgaggagtaaaaaa
ggggacttagtttttgcgataagtcaaagcggtgaaacaatagatgtacttcaagggata
agaatgatgcgaaatagtggtgctaaaattatctctctaactaacgttatagaaagtgct
atagctagagaaagcgattataaaatctacatgagggcaggaccagaaattggtgtagcc
gcaacaaaaacttttacaacacaattagcttcaattctcttcatcctatccgttttaaag
aaggagaatctaaagaaaatggaaaaagctccagatatagtgagagatacaatatcacaa
gtagaaggattaacaaagaaaattggagaagaattagctaagaaaagtaatatatactac
ttgggtagaggactctcactaccactagcaatggaaggtgcattaaaaataaaagaaata
gcttatgtacatgccgaagcatatcctgctggtgaaagtaagcatgggccaatatctcta
gtagaaaaaggattcccagtagttataataaatgatggtgaattaacagaactcttacaa
aataatttaatggaaatgaaggctagaggggctagaatttatgcagtaagcgtgaataaa
aagatgaaagatgctgatgttgaaatagagcttcagtccgagatcccagtattatctata
gccccagtaatccaattaatagcatattatgctgcagtaactaaaggatatgacccagat
aaaccaagaaacttagctaaaacagttactgtagaataa

DBGET integrated database retrieval system