KEGG   Sulfolobus tokodaii: ST2268Help
Entry
ST2268            CDS       T00062                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2268
   01230 Biosynthesis of amino acids
    ST2268
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ST2268
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ST2268
Enzymes [BR:sto01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ST2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2277160..2277981
Genome map
AA seq 273 aa AA seqDB search
MEGGRRDGIPISIEELNKLKNIAERARRNVVKMLFYDQTIHVGSSLSSIEILTTLLFRYI
REGKDPINRDWLILSKGHAAPALYAILVEKGYINEDELWKIQDISGLLQGHPEIHIPGID
MSTGSLGQGLSFGIGVAQGIKMRGGNGRVFVIMGDGEQDEGEVWEAMTHAVTRKLDNIIA
FIEMNGFQLDAATSEVKPKDFLPDVWKAVGWKTLSCDGHDFISLINTIEEALKAKAPVVI
FAKTRRGMGFKAIENTEKQRASPDDAKKYLTNA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggagacgtgatggaattccaatatcaatagaggagctaaataagttaaag
aatattgctgaaagagcaagaagaaatgtagtaaagatgctattttatgatcaaacaatc
catgttggttcatcgcttagtagtatagagatattaactacattattgtttagatatata
agggaaggaaaggatcctataaatagggattggttaatactaagtaaagggcatgcagca
cccgcattatatgctattttggtagaaaaagggtatattaatgaagatgaattatggaaa
atccaggatatctctggcctattacaaggacatccagaaattcatatacctggtattgat
atgtctaccggaagtttaggacaaggtttaagtttcggtataggtgttgcccaaggaata
aaaatgagaggaggaaatggaagagtatttgtaataatgggagacggagagcaagatgag
ggtgaagtttgggaagctatgactcatgcagttactagaaaattagataatattattgca
ttcatagaaatgaacggttttcagttagatgctgcaacatctgaagtaaaaccaaaagat
ttcttaccagatgtatggaaggctgttggttggaaaacgttaagttgtgatggtcatgat
tttataagtttaataaatacaatcgaggaagcattaaaggcaaaggctccggtagttatt
tttgctaagacaagaagaggtatgggattcaaggcgatagaaaatactgaaaaacagagg
gcgagtccagatgatgcaaagaagtaccttaccaatgcgtga

DBGET integrated database retrieval system