KEGG   Sulfolobus tokodaii: ST2268Help
Entry
ST2268            CDS       T00062                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
sto  Sulfolobus tokodaii
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ST2268
   01230 Biosynthesis of amino acids
    ST2268
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ST2268
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ST2268
Enzymes [BR:sto01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ST2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2277160..2277981
Genome map
AA seq 273 aa AA seqDB search
MEGGRRDGIPISIEELNKLKNIAERARRNVVKMLFYDQTIHVGSSLSSIEILTTLLFRYI
REGKDPINRDWLILSKGHAAPALYAILVEKGYINEDELWKIQDISGLLQGHPEIHIPGID
MSTGSLGQGLSFGIGVAQGIKMRGGNGRVFVIMGDGEQDEGEVWEAMTHAVTRKLDNIIA
FIEMNGFQLDAATSEVKPKDFLPDVWKAVGWKTLSCDGHDFISLINTIEEALKAKAPVVI
FAKTRRGMGFKAIENTEKQRASPDDAKKYLTNA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggagacgtgatggaattccaatatcaatagaggagctaaataagttaaag
aatattgctgaaagagcaagaagaaatgtagtaaagatgctattttatgatcaaacaatc
catgttggttcatcgcttagtagtatagagatattaactacattattgtttagatatata
agggaaggaaaggatcctataaatagggattggttaatactaagtaaagggcatgcagca
cccgcattatatgctattttggtagaaaaagggtatattaatgaagatgaattatggaaa
atccaggatatctctggcctattacaaggacatccagaaattcatatacctggtattgat
atgtctaccggaagtttaggacaaggtttaagtttcggtataggtgttgcccaaggaata
aaaatgagaggaggaaatggaagagtatttgtaataatgggagacggagagcaagatgag
ggtgaagtttgggaagctatgactcatgcagttactagaaaattagataatattattgca
ttcatagaaatgaacggttttcagttagatgctgcaacatctgaagtaaaaccaaaagat
ttcttaccagatgtatggaaggctgttggttggaaaacgttaagttgtgatggtcatgat
tttataagtttaataaatacaatcgaggaagcattaaaggcaaaggctccggtagttatt
tttgctaagacaagaagaggtatgggattcaaggcgatagaaaatactgaaaaacagagg
gcgagtccagatgatgcaaagaagtaccttaccaatgcgtga

DBGET integrated database retrieval system