KEGG   Sulfolobus tokodaii: STK_02050Help
Entry
STK_02050         CDS       T00062                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
sto  Sulfolobus tokodaii
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sto00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    STK_02050 (aspS)
Enzymes [BR:sto01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     STK_02050 (aspS)
Amino acid related enzymes [BR:sto01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   STK_02050 (aspS)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    STK_02050 (aspS)
 Prokaryotic Type
   Other AARSs
    STK_02050 (aspS)
Mitochondrial biogenesis [BR:sto03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    STK_02050 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
227743..229032
Genome map
AA seq 429 aa AA seqDB search
MYRSHFIADVTPEYDGKEVIWAGWVHLLRDLGGKKFIILRDKTGLGQVVVDKNSSAFGIS
QELTQESVIQVRGIVKADKRAPRGIELHAEEITLLSKAKAPLPLDVSGKVKADIDTRLRE
RVLDLRRQEMQAVIKIQSLALKAFRETLYKEGFIEIFTPKIIASATEGGAQLFPVIYFGK
EAFLAQSPQLYKELMAGVVERVFEVAPAWRAEESDTPFHLAEFISMDVEMAFADYNDVMQ
LLEKILHNIVKTIKEEGKEELKILNYEPPEVKIPIKRLKYTEAIEILRSKGYNIKFGDDI
GTPELRILNEELKEDLYFIVDWPSDARPFYTKSKSENPELSESFDLIYKFLEIVSGSTRN
HKREVLEEALKKKGLKPESFEFFLKWFDYGMPPHAGFGMGLARLMVMLTGIQSVKEIVPF
PRDKKRLTP
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtatagaagtcatttcattgctgatgtaactccagaatatgatggaaaagaagtaata
tgggctggatgggttcatcttttgcgcgacttaggtggtaagaaatttataatacttaga
gataagactggtttaggtcaagtagtagtagacaaaaactctagtgcttttggtatttcg
caagaacttacacaagaaagtgttatccaagtgagaggtatagtaaaagctgataaaaga
gctcctagaggaatagaactccatgcagaagaaataactttactaagtaaagcaaaagca
cctttgcctttagatgtttctggtaaagtaaaagctgatatagatactagacttagagag
agagtattagatttaagaagacaagaaatgcaagcagtaataaaaatccaatctttagca
ctaaaggcttttagagaaacattatataaagaaggatttattgaaattttcaccccaaag
attatagcatcagctactgagggtggtgcacaattatttcccgtgatatactttggtaag
gaggcatttttagcgcaaagcccacagctttataaagagcttatggctggagtagtagaa
agagtttttgaagttgctcctgcttggagagctgaagaatctgatacaccgtttcattta
gcagaatttattagtatggatgtagaaatggcgtttgctgattataacgatgtaatgcaa
cttttagagaaaatattacataatattgtaaagaccataaaagaagaaggaaaagaagag
ctaaaaattttaaattatgaaccaccagaagtaaagatacctattaaaagattaaagtac
actgaagcaatagaaatcttaagaagtaaaggatacaatattaaatttggagatgatata
ggaacacccgaattaagaatacttaatgaggaactaaaagaggatttatatttcattgtt
gattggccctcagatgcaagaccattctatactaaaagtaaaagtgagaacccagaatta
agcgaaagtttcgatttaatctataaatttttagaaatagtatcaggaagcacaagaaat
cataagagagaagtactagaagaagcattaaagaaaaaaggattgaaaccagagagcttc
gagtttttcctaaaatggtttgattatggaatgccacctcacgccggatttggaatggga
ctagcaaggctaatggtaatgttaacgggaatacagagcgttaaggaaatagttcccttc
cctagagataagaaaagactaacaccctaa

DBGET integrated database retrieval system