KEGG   Salinispora tropica: Strop_0215Help
Entry
Strop_0215        CDS       T00504                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
stp  Salinispora tropica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:stp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
245263..245856
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLAGALRKVKELVRFCTSCY
NVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGIGPDN
LRVRELLTRLGGGAVRELILATDPNTEGEATATYLALMVKPMGIAVTRLASGLPVGGDLE
YADEITLGRAFEGRRTV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggcgctatccaggacctgattgacgagttgggccggctgccgggcgtgggc
ccgaagagcgcccagcggatcgcctttcatgtcctgtccgcggacccggccgacgtcaat
cggctggccggcgcgttgcgcaaggtcaaggagttggtgcgcttctgcaccagctgctac
aacgtggccgagtccgagcagtgccggatctgccgcgatccacgccgtaccgatgaggtg
ctctgcgtggtggaagagccgaaggacgtggtggcgatcgagcggaccggggagttccgc
ggccggtaccacgtcctcggcggcgcgatcaacccgctggaggggatcgggccggacaat
ctgcgcgtccgggagttgctgacccggctgggcggtggcgcggtgcgggagctgatcctg
gccaccgatccgaataccgagggcgaggcgaccgccacctatctggcgctgatggtgaag
ccgatgggcatcgccgtgactcggctggccagtggcctgccggtcggcggcgacctggag
tacgccgacgagatcactcttggtcgtgctttcgagggacgccggacggtctga

DBGET integrated database retrieval system