KEGG   Salinispora tropica: Strop_0215Help
Entry
Strop_0215        CDS       T00504                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
stp  Salinispora tropica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Strop_0215
DNA repair and recombination proteins [BR:stp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Strop_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
245263..245856
Genome map
AA seq 197 aa AA seqDB search
MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLAGALRKVKELVRFCTSCY
NVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYHVLGGAINPLEGIGPDN
LRVRELLTRLGGGAVRELILATDPNTEGEATATYLALMVKPMGIAVTRLASGLPVGGDLE
YADEITLGRAFEGRRTV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagggcgctatccaggacctgattgacgagttgggccggctgccgggcgtgggc
ccgaagagcgcccagcggatcgcctttcatgtcctgtccgcggacccggccgacgtcaat
cggctggccggcgcgttgcgcaaggtcaaggagttggtgcgcttctgcaccagctgctac
aacgtggccgagtccgagcagtgccggatctgccgcgatccacgccgtaccgatgaggtg
ctctgcgtggtggaagagccgaaggacgtggtggcgatcgagcggaccggggagttccgc
ggccggtaccacgtcctcggcggcgcgatcaacccgctggaggggatcgggccggacaat
ctgcgcgtccgggagttgctgacccggctgggcggtggcgcggtgcgggagctgatcctg
gccaccgatccgaataccgagggcgaggcgaccgccacctatctggcgctgatggtgaag
ccgatgggcatcgccgtgactcggctggccagtggcctgccggtcggcggcgacctggag
tacgccgacgagatcactcttggtcgtgctttcgagggacgccggacggtctga

DBGET integrated database retrieval system