KEGG   Salinispora tropica: Strop_0230Help
Entry
Strop_0230        CDS       T00504                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
stp  Salinispora tropica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Strop_0230
Enzymes [BR:stp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Strop_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(263470..265695)
Genome map
AA seq 741 aa AA seqDB search
MADVTAAPRPALATLDAVLERLTYVNEESGYTVARVATDRGSDLLTVVGALLGAQPGESL
RLHGRWSSHPKYGRQFEVDSYTTVLPATIQGIQRYLGSGLVKGIGPVFAERIVAHFGLET
LRIIEEEPARLVEVPGLGPKRTAKITAAWEEQQAIKEVMVFLQGVGVSTSLAVRIYKQYG
DTSTDVVTKEPYRLAADVWGIGFKTADTIAQSVGIPHDSPQRVMAGLQYTLSEATDNGHC
YLPEPELIADATKILDVPADLVTRCLDDLVAEEGVVRESLPGGDAEPVRAVYLVPFHRAE
RSLATSLLRLLDDGTDRLPHFAGVDWAKALTWLKARTGNDLAPEQEQAVRLALTSKVAVL
TGGPGCGKSFTVRSIVELAAAKRAKVTLVAPTGRAAKRLSELTGHPAATVHRLLQLRPGG
DASYDRDNPLDVDLLVVDEASMLDLILANKLVKAVPPGAHLLLVGDVDQLPSVGAGEVLR
DLLAAPAIPRVRLTQIFRQAAQSGVVTNAHRINAGRPPLLQGLPDFFLFACDDTEATAER
TVDVACSRIPAKFRLDPRRDVQVLTPMHRGPAGSGALNTLLQQRLTPHREGQPERRAGGR
VFRIGDKVTQIRNNYDKGEAGVFNGTLGIVTQLSTEEQTLTVRTDEDESIDYDFDELDEL
AHAYAMTIHRSQGSEYPAVVIPLTTSAWMMLQRNLLYTAVTRAKQLVVLVGSRRALAAAV
RTVGAGRRHTALNHRLAAATP
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgtgaccgctgccccccgtcccgcgctggcgacgctcgacgcggttctagag
cgacttacgtacgtcaacgaggaatccggctacaccgtcgcccgggtcgccaccgaccgc
ggtagtgatctgttgacggtggtgggtgcgctgctgggcgcgcagccaggggagagcctg
cggctgcacgggcgctggtcctcgcaccccaagtacggtcggcagttcgaggtcgactcg
tacaccacggtcctgccggccacgatccagggcatccagcgctacctcggctcgggcctg
gtgaagggcatcgggccggttttcgccgagcggatcgtcgcccatttcggcctggagacg
ctgcggatcatcgaggaggagccggcccgcctggtggaggtgccggggttgggcccgaaa
cgcaccgcgaagatcaccgcggcgtgggaggaacagcaggcgatcaaggaggtcatggtc
ttcctccagggggtcggcgtctcgacctccctcgcggtacggatctacaagcagtacggc
gacacctccaccgacgtggtcacgaaggagccgtaccggctggcagccgatgtgtgggga
atcggcttcaagaccgccgacaccatcgcccagtcggtcggtattccgcacgacagcccg
cagcgggtcatggctggcttgcagtacacgctctccgaggccaccgacaacggccactgc
tacctacccgaaccggagctgatagcggacgccacgaaaatcctcgatgtgccggccgac
ctcgtcacccgctgcctggatgacctggtcgccgaggagggcgtcgtccgggagtcgcta
ccgggcggcgacgcggagccggtgcgggcggtgtatctggtgccgttccaccgggcggag
cggtctctggccaccagcctgctccgcctgctcgacgatgggaccgatcggttgcctcac
ttcgcgggcgtcgactgggccaaggccctgacctggctgaaggcgcgtaccggcaacgac
ctcgcccccgagcaggagcaggcggttcggctcgcgctgacctcgaaggtcgcggtgctg
accggtgggccggggtgcggcaagagcttcaccgtccgttcgatcgtcgaactggcggct
gccaagagagccaaggtcaccctggtggccccgaccgggcgggccgccaagcgtctctcc
gagctgaccgggcaccccgccgccacggtgcatcgcctgttgcagctacgcccgggcggg
gacgcctcctacgaccgggacaaccccctcgacgttgacctgctcgtcgtggacgaagcc
tccatgctcgacctcatcctggccaacaagctcgtcaaggccgtcccacccggcgcgcac
ctgctgctggtcggcgatgtcgaccagctcccctccgtcggtgccggtgaggtgttgcgc
gatctactcgccgctccagccatcccgcgggtgcggttgacccagatcttccgccaggcc
gcccagtccggcgtcgtcaccaacgcccaccgcatcaacgccggccgcccgcccctgctc
cagggcctgccggatttcttcctcttcgcctgcgacgacacggaggccaccgccgagcgc
accgtcgatgtcgcctgttcccgcatcccggccaagttccgcctcgacccccgccgggac
gtacaggtcctcacccccatgcaccgcggccccgccggctcgggggcgttgaacaccctg
ctccagcaacggctcaccccgcatcgggaggggcagccggagcggcgagccggcgggcgg
gtgttccgcatcggcgacaaagtcacccagattcgcaacaactacgacaagggcgaggcg
ggcgtcttcaacggcactctcggcatcgtcacccagctctcgaccgaggagcagacgctg
acggtccgcaccgacgaggacgagagcatcgactacgacttcgacgaactcgacgagctg
gcccacgcctacgccatgaccatccaccgctcgcagggctcggaatacccggcggtcgtc
atcccgctgaccaccagcgcctggatgatgctgcaacgcaacctgctctacaccgccgtc
acccgcgccaaacaactcgtcgtcctggtcggctcccgccgggccctcgccgccgcggtc
cgcaccgtcggcgccggccgtcggcacaccgccctcaaccaccggctggccgccgcaacg
ccctga

DBGET integrated database retrieval system