KEGG   Salinispora tropica: Strop_0263Help
Entry
Strop_0263        CDS       T00504                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
stp  Salinispora tropica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strop_0263
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_0263
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Strop_0263
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Strop_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
299263..300549
Genome map
AA seq 428 aa AA seqDB search
MTSALAPSGIDPATSPARALACRACSARYPLIAQHACYECFGPLEVDHDPTALATVTREQ
IEAGPRNIWRYAPLLPVGQDPATRVTLDPGFTPLVAAPRLAAEVGLTAPLWVKDDSANPT
HSFKDRVVSVALTAARSLGFTRFACASTGNLANSVAAHAARAGAPSVVFIPSDLEQGKVV
TTAVYGGDLVAIDGSYDDVNRLCGELVETDEFEDTAFVNVNVRPYYAEGSKTLGYEVAEQ
LGWRIPAQVVIPMASGELLTKVDKAFAELVEIGLVEAPAGGWRVFGAQSAGCSPIAAALH
ADSDTINPVKPTGIAKSLNIGDPAAGPYALESVRRTGGWMAAADDDEIRAGIRLLARTAG
VFAETAGGVTVAVLRKLVESGRLDPTAETVIFNTGEGLKTLDAVADQAGPSHRIKASLRA
ARDAGLMG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacatccgcgctcgccccgtccgggatcgaccccgccaccagcccggctcgtgccctg
gcctgccgcgcctgttcggcccggtacccgctcatcgcccagcacgcctgttacgagtgc
ttcggcccgctggaggtcgaccacgaccccaccgcgctggccaccgtcacccgtgagcag
atcgaggccggcccgcgcaacatctggcggtacgcgccattgctgcccgtcggtcaggac
ccggccacccgggtcaccctcgacccgggcttcaccccgctggtcgcggccccgcggctg
gccgccgaggtgggcctcaccgcgccgctctgggtcaaggacgacagcgccaatccgacc
cactcgttcaaggaccgggtggtgtcggtggcgctgaccgccgcccggtcgttgggcttc
acccggttcgcctgcgcctccaccggaaacctggccaactcggtcgccgcgcacgccgcc
cgggccggggccccgtcggtggtgttcatccccagcgacctggagcagggcaaggtggtc
accaccgccgtgtacggcggggacctggtcgcgatcgacgggtcgtacgacgacgtgaac
cggctctgcggcgagttggtggagaccgacgagttcgaggacaccgccttcgtcaacgtc
aacgtgcggccctactacgccgagggctcgaagacgctcggctacgaggtggccgagcag
ctcggttggcggatccccgcccaggtggtgattccgatggcctccggtgagctgctgacg
aaggtcgacaaggcgttcgccgagttggtcgagatcggcctggtcgaggcgccggccggc
ggctggcgggtgttcggggcgcagtcggcgggctgtagcccgatcgccgctgccctgcac
gctgacagtgacaccatcaacccggtcaagccgaccggcatcgccaagtcgctgaacatc
ggtgacccagccgccggcccgtacgccctggagtcggtccgccgtaccggtggttggatg
gcggcggcggacgacgacgagatccgggccgggatccggctgctcgcccgtaccgccggt
gtcttcgccgagaccgctggcggggtgaccgtggcggtgctgcgaaaactcgtcgagtcc
ggccggctcgacccgaccgctgagacggtgatcttcaataccggtgaggggctcaagacc
ctggacgcggtggcggatcaggcgggcccgagccatcggatcaaggcatcgctgcgggcg
gcccgggacgccggtctgatgggctga

DBGET integrated database retrieval system