KEGG   Salinispora tropica: Strop_0335Help
Entry
Strop_0335        CDS       T00504                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stp  Salinispora tropica
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strop_0335
   01230 Biosynthesis of amino acids
    Strop_0335
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strop_0335
  Energy metabolism
   00680 Methane metabolism
    Strop_0335
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_0335
Enzymes [BR:stp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Strop_0335
Exosome [BR:stp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Strop_0335
  Exosomal proteins of melanoma cells
   Strop_0335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
387363..388139
Genome map
AA seq 258 aa AA seqDB search
MAGMTASEGPTIGTLVLLRHGESDWNAKNLFTGWVDVDLTGKGETEARRGGELLREHNLL
PDVVHTSLLRRAIRTAELALDAAERHWIAVRRSWRLNERHYGALQGKNKKQTLDEYGEEQ
FMLWRRSYDTPPPPIADDDEWSQVGDPRYRLLPTELMPRTECLKDVVDRMLPYWYDSIVP
DILAGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRYDLDPQLRPMTLGGTY
LDPAAARDAAAAVANQGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccggcatgactgctagtgaggggcccaccatcgggacgctggtcctgttacgacac
ggtgagagcgactggaacgccaagaacctcttcaccggctgggtcgacgtggacctgacc
ggcaagggcgagaccgaggcgcgtcgtggcggtgagctgctgcgtgagcacaacctgctg
ccggacgtggtacacaccagcctgcttcgccgggcgatccgtactgcggagctggcgttg
gacgccgccgaacgacactggatcgcggtgcgtcggtcgtggcggctcaacgagcgtcac
tacggcgccctgcagggcaagaacaagaagcagacgctcgacgagtacggcgaggagcag
ttcatgctctggcgtcgctcgtacgacacgccgccgccgccgatcgcggacgacgacgag
tggtcgcaggtcggtgacccgcgctaccggttgctgccgaccgagctgatgccgcggacg
gagtgcctgaaggacgtcgtcgatcggatgctgccgtactggtacgactcgatcgtgccg
gacatcctggccggccggacggtgctggtcgccgcgcacggcaactcgctgcgcgccctg
gtcaagcatctggaccagatcagcgacgaggcgatcgcgaagctgaacatcccgaccggg
atcccgctgcggtacgacctcgacccgcagctgcgtccgatgacgctcggcggcacctac
ctggacccggcggcggcgcgggatgccgccgcagcggtagcgaaccagggtcgctga

DBGET integrated database retrieval system