KEGG   Salinispora tropica: Strop_0497Help
Entry
Strop_0497        CDS       T00504                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
stp  Salinispora tropica
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:stp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
575604..577127
Genome map
AA seq 507 aa AA seqDB search
MTERFVVAIDQGTTSTRCIVFDRRGNLVSVAQREHRQHFPRPGWVEHDAMEIWRNVGKVV
PRALTQAGITIDQIAAIGIANQRETTIVWDRRTGVPVAPALIWQDTRTDLVVDALTRASG
AADIQELCGLPLTTYFSGPKLRWLLDHVPGLAERADRGEVLFGTMESWLIWNLTGGPDGG
LHLTDVTNASRTMLMDLRTLDWHPRLLSFFGVPAAMLPQIRSSSEVYGTATAVLPGVRIA
AALGDQQAALFGQTCFDPGDAKCTYGTGSFLLLNTGTEPVPSRHGLLTTVGYRIGGEPAL
YALEGSIAITGSLVQWFRDRLELISTAPEIETLARTVGDNGGCYIVPAFSGLFAPHWRSE
ARGMIVGLTSYITKGHLARAVLEATGWQTREVVDAMNADSGLDLTTLRVDGGMTANNLLM
QFVADVLAVPVVRPMAAETVSLGAAYAAGLAVQYWPDLEGLRSNWHPAARWVPEMDAAVR
TRERENWRRAVERTFDWIRPTEDPARR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgctttgtcgtcgctatcgatcagggaaccacgtccacccggtgcatcgtc
ttcgaccgccgtggcaacctcgtctcggtggcccagcgggaacaccggcagcattttccc
cggcctggctgggtagagcacgacgctatggagatctggcgcaacgtcggcaaggttgtt
ccccgcgccctcacccaggctggcatcaccatcgaccagatcgccgcgatcgggatcgcc
aaccagcgcgaaaccacgatcgtctgggaccggcgtaccggtgtcccggtggctcccgcg
ctcatctggcaggacacccgcaccgacctggtggtggacgccctcacccgggccagcggc
gccgccgatattcaggagctgtgtgggctgccgctgaccacgtacttctccggcccgaag
ctgcgctggctgctcgaccacgtccccggcctcgccgaacgcgccgatcgcggcgaggtg
ctcttcgggaccatggagagctggctgatctggaaccttaccggcggcccggacggtggc
ctgcatctgaccgacgtcaccaacgccagccgtaccatgctgatggacctgcgcactctc
gactggcaccccagactgctgagcttcttcggcgtgccggccgccatgctgccgcagatc
cgctcctcgtcggaggtgtacggcaccgccacagccgtcctgcccggcgtccggatcgcg
gcggccctcggtgaccagcaggctgccctgttcggtcaaacctgcttcgacccaggcgac
gccaagtgcacctatggcaccggcagcttcctgctgctgaacaccggtaccgagccggtg
ccttcgcggcacggcctgctcaccaccgtcggctaccggatcggcggcgagccggccttg
tacgccctggaggggtccatcgcgatcacaggatccctggtgcagtggttccgcgaccgg
ctggagctgatcagtaccgcaccggaaatcgagaccctcgcccgaacagtcggcgataac
ggcggctgctacattgtgcccgccttctccgggctattcgccccacactggcgcagcgag
gcgcgcggcatgatcgtcggactcacctcctacatcaccaaggggcacctggcccgggct
gtgctggaggcgaccgggtggcagacccgtgaggtggtcgacgccatgaacgccgactcc
gggctggatttgaccaccttgcgggtggacggcgggatgaccgcgaacaacttgctgatg
cagttcgtcgcggacgtactcgcggtgccggtggtgcgcccgatggcggccgagacggtc
tccctcggggccgcatacgcagccgggctcgcggttcagtactggccagatctggagggc
ctgcgtagcaactggcacccggctgcccgatgggtgccggagatggatgccgcagtccgg
acacgggaacgggaaaactggcggcgggcggtggagcgcaccttcgactggatccggccc
acagaggaccctgctcgccgctga

DBGET integrated database retrieval system