KEGG   Salinispora tropica: Strop_0678Help
Entry
Strop_0678        CDS       T00504                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stp  Salinispora tropica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strop_0678
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_0678
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strop_0678
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strop_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
762677..764017
Genome map
AA seq 446 aa AA seqDB search
MTETPRAWRSVLPHLGYELPADVTPQRTGGPMIATLPLELIRQSVATREFWPIPEPVAER
YRSYRPAPLWRARRFEAEIGATVPIYVKYEGGNISGSHKFNTALAQAHYYHRAGFRELVT
GTGAGQWGSALAAACAAFGIACTVFMVGGSLRDKPYRGSLMRLYNAELHASPSRLTHVGR
VAAERSGQGNSLALAIGEAVEYARADPKRAFCIGSGETYSILHQSVIGLEAIDQLAALDA
SVEAVIGCVGAGSNFGGLALPFFAADSAGERDVPTELIAVESSTTPKLTRGVYAFDHTDS
TGTGPMEAMYTIGSGYAIPASHSAGLRFHGAAKLISAMRYRDQISALAVGQREALTAGRT
FALTELVVPAPESGHALAAAARVATGREPGHPARRGLLVCISGHGLLDLAAYDKLLAGLP
EDRAADSDALRAATASLRAVHPMGGA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagacacctcgagcctggcgcagcgtcctgccgcaccttggctacgagctgccc
gccgatgtgacgccgcagcgcaccggtggcccgatgatcgccactttgccgctagagctg
atccggcagagtgtcgcaacccgggagttctggccgatccccgagccggtcgccgagcga
taccgaagctaccggccggcgccgctgtggcgggcccggcgcttcgaggccgagatcgga
gcgaccgtcccgatctatgtgaagtacgagggtggcaacatctcgggtagccacaaattc
aacactgcgctggcgcaggcccactactaccaccgcgcaggcttccgggagctggtcact
ggaaccggtgccgggcagtggggcagcgcgctcgccgccgcgtgcgccgcattcggcata
gcctgcaccgttttcatggtcggcgggagcctacgcgataagccgtatcggggcagcctg
atgcgcctctacaacgcggaactgcacgccagccccagccgactgacacacgtgggacgc
gttgccgccgagcggtcggggcagggcaacagcctcgcgttagccatcggcgaggccgtc
gagtatgcgagagcggaccccaagcgggcgttttgtatcggcagtggcgagacatacagc
atcctgcaccagtcggtgatcggcctggaagccatcgaccagcttgctgctcttgacgcc
agcgtggaggcggtgatcggttgcgtgggtgccggcagcaacttcggcgggctggccctg
ccgttcttcgccgccgactccgccggggagcgggacgtgcccaccgaattgatcgcggtg
gagtccagcaccaccccgaaactcacccgtggggtgtacgcctttgaccacacggactcc
accggcaccggaccgatggaggcgatgtacacgatcggcagcgggtacgcgatccccgca
tcgcactcggcgggattgcgcttccacggtgcggcgaagctcatctctgcgatgcggtac
cgagaccagatctcggcgttggcggtgggccagcgggaggcgctgaccgctggccgtacg
ttcgccctgaccgagctggtagtgccggcaccggagtcgggtcacgcgctggcggccgct
gcccgggtagcgacgggccgcgaacccgggcacccagcgcggcgcgggctgctggtctgt
atcagcgggcacggcctgctcgacctggccgcatacgacaagctcctcgccggtttgccc
gaggaccgcgcagccgactcggacgcgttgcgggcggcgacggcgtcgctgcgcgcagtc
cacccgatgggaggagcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system