KEGG   Salinispora tropica: Strop_0678Help
Entry
Strop_0678        CDS       T00504                                 

Definition
(GenBank) Tryptophan synthase (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stp  Salinispora tropica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strop_0678
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_0678
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strop_0678
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strop_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
762677..764017
Genome map
AA seq 446 aa AA seqDB search
MTETPRAWRSVLPHLGYELPADVTPQRTGGPMIATLPLELIRQSVATREFWPIPEPVAER
YRSYRPAPLWRARRFEAEIGATVPIYVKYEGGNISGSHKFNTALAQAHYYHRAGFRELVT
GTGAGQWGSALAAACAAFGIACTVFMVGGSLRDKPYRGSLMRLYNAELHASPSRLTHVGR
VAAERSGQGNSLALAIGEAVEYARADPKRAFCIGSGETYSILHQSVIGLEAIDQLAALDA
SVEAVIGCVGAGSNFGGLALPFFAADSAGERDVPTELIAVESSTTPKLTRGVYAFDHTDS
TGTGPMEAMYTIGSGYAIPASHSAGLRFHGAAKLISAMRYRDQISALAVGQREALTAGRT
FALTELVVPAPESGHALAAAARVATGREPGHPARRGLLVCISGHGLLDLAAYDKLLAGLP
EDRAADSDALRAATASLRAVHPMGGA
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagacacctcgagcctggcgcagcgtcctgccgcaccttggctacgagctgccc
gccgatgtgacgccgcagcgcaccggtggcccgatgatcgccactttgccgctagagctg
atccggcagagtgtcgcaacccgggagttctggccgatccccgagccggtcgccgagcga
taccgaagctaccggccggcgccgctgtggcgggcccggcgcttcgaggccgagatcgga
gcgaccgtcccgatctatgtgaagtacgagggtggcaacatctcgggtagccacaaattc
aacactgcgctggcgcaggcccactactaccaccgcgcaggcttccgggagctggtcact
ggaaccggtgccgggcagtggggcagcgcgctcgccgccgcgtgcgccgcattcggcata
gcctgcaccgttttcatggtcggcgggagcctacgcgataagccgtatcggggcagcctg
atgcgcctctacaacgcggaactgcacgccagccccagccgactgacacacgtgggacgc
gttgccgccgagcggtcggggcagggcaacagcctcgcgttagccatcggcgaggccgtc
gagtatgcgagagcggaccccaagcgggcgttttgtatcggcagtggcgagacatacagc
atcctgcaccagtcggtgatcggcctggaagccatcgaccagcttgctgctcttgacgcc
agcgtggaggcggtgatcggttgcgtgggtgccggcagcaacttcggcgggctggccctg
ccgttcttcgccgccgactccgccggggagcgggacgtgcccaccgaattgatcgcggtg
gagtccagcaccaccccgaaactcacccgtggggtgtacgcctttgaccacacggactcc
accggcaccggaccgatggaggcgatgtacacgatcggcagcgggtacgcgatccccgca
tcgcactcggcgggattgcgcttccacggtgcggcgaagctcatctctgcgatgcggtac
cgagaccagatctcggcgttggcggtgggccagcgggaggcgctgaccgctggccgtacg
ttcgccctgaccgagctggtagtgccggcaccggagtcgggtcacgcgctggcggccgct
gcccgggtagcgacgggccgcgaacccgggcacccagcgcggcgcgggctgctggtctgt
atcagcgggcacggcctgctcgacctggccgcatacgacaagctcctcgccggtttgccc
gaggaccgcgcagccgactcggacgcgttgcgggcggcgacggcgtcgctgcgcgcagtc
cacccgatgggaggagcgtga

DBGET integrated database retrieval system