KEGG   Salinispora tropica: Strop_0812Help
Entry
Strop_0812        CDS       T00504                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
stp  Salinispora tropica
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Strop_0812 (deoA)
Enzymes [BR:stp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Strop_0812 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
902111..903391
Genome map
AA seq 426 aa AA seqDB search
MADFAAVDVIRAKRDGAALSDAQVDWVVDAYTRGQVADEQMAALAMAILLNGMTAPEIAR
WTAAMISSGERLDLSAVDRPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHT
GGTLDKLESIPGWRASLGNEEFIAQLRGVGAVICAAGAGLAPADRKLYALRDVTGTVEAI
PLIASSIMSKKIAEGTGALVLDVKVGSGAFMKSVDQARQLARTMVELGGAQGVHTVALLT
DMSTPLGLAIGNAVEVTESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPAAALRDG
RAMDAWRAMLRAQGGDPDAQLPTAREVEVVRADESGVVAQVDAYGMGVAAWRLGAGRARK
EDAVSAPAGVLLHKRPGDPVRAGEPLFELRAEDADRIPEARKEAVRAVRIAASAPEKRPL
VLERIS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcggattttgcggcggttgatgtcattcgggcgaagcgggacggcgcggccctctcc
gatgcacaggtcgactgggtggtggacgcctacacccggggccaggtggcagacgagcag
atggccgcgctcgcgatggcgatcctgctgaacgggatgaccgcgccggagatcgcccgg
tggaccgcggcgatgatctccagcggagagcggctggacctctcggcggtcgaccggccg
acggtggacaagcactcaaccggcggagtcggagacaagatcaccctgccgctgactccg
ttggtggcggcctgtggtgcggcggtgccgcagctgagcggccggggcctcgggcacacc
ggcggcacgctggacaagctggagtccattccgggctggcgggcatcgctgggcaacgag
gagttcattgctcagctccgcggcgtcggtgcggtgatctgtgcggccggcgccggtctc
gcgccggccgaccgcaagctgtacgcactgcgggacgtgaccggcacggtggaggccatt
ccgctgatcgccagctcgatcatgagcaagaagatcgctgaggggaccggcgctctggtg
ctcgacgtcaaggtcggctcgggcgcgttcatgaagtcggtcgaccaggcccggcaactc
gcccgcaccatggtcgagctgggcggtgcgcagggcgtccacacggtcgcgttgctcacc
gacatgtccaccccgctggggttggccatcggcaacgcggtcgaggtgaccgaatccgtg
gaggtcctggctggcggcggaccggccgacgtggtggagctgaccctggccctggcccgc
gagatgctggacgcggccgggctgccggacgccgacccggcggcggcgttgcgcgacggc
cgggcgatggatgcctggcgagcgatgctccgggctcagggcggggacccggacgcccag
ctgcccaccgcgcgggaggtcgaggtggtccgcgccgacgaaagcggcgtggtggcccag
gtcgacgcgtacggcatgggggtggccgcgtggcggctcggtgccggacgggcccgcaag
gaggacgcggtgtccgcgccggcgggcgtgctgctgcacaagcgccccggtgatcccgtt
cgggctggcgagcccctctttgagctgcgggccgaggacgccgaccggatcccggaggcc
cggaaggaggcggtgcgggcggtacggatcgcggcgtctgcaccggaaaagcggccgctg
gtgctcgagcgaatcagctga

DBGET integrated database retrieval system