KEGG   Salinispora tropica: Strop_1139Help
Entry
Strop_1139        CDS       T00504                                 

Definition
hypothetical protein
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
stp  Salinispora tropica
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Strop_1139
Enzymes [BR:stp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Strop_1139
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Strop_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1284504..1285232
Genome map
AA seq 242 aa AA seqDB search
MTAVPTSGFSAFALEPFPELQAGVDLAGAITGVLACTGIELQEGDVVVVASKAVSVAEKR
YVDLASVVVGPEALELSARTGKPAEVVQLILDSSDSYFLATEKGPIIARHRLGFQLTSAG
IDRAGPQGAWLLPVDPDASARALRDALIAHTGAEVAVVVADSDGRADRRGATVISIGAAG
VGPLRVTEYGGKRQEETFTDLIAAAAGIILGQRGRGAPVAVLRGVAYESSDAGVASMLQR
RP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctgtcccgacctccggtttctccgctttcgcgctggaaccttttcccgagctc
caggctggtgtggacctggcgggcgccatcaccggcgtcctggcctgtacgggtatcgag
ttgcaggagggggatgtggtggtggtggcttccaaggccgtgagtgtggcggagaagcgg
tacgtggatctggccagtgtcgtcgttggcccggaggcgctggagttgtccgctcgcacg
ggcaagcccgccgaggtggtgcagctgatcctggattccagtgacagctacttcctggcc
accgagaagggcccgatcatcgcgcggcaccggctcggcttccagctcacctccgccggg
attgaccgggccggcccgcagggtgcgtggctgttgccggtggatccggacgcctccgcc
cgcgccctgcgcgacgcgttgatcgcccataccggcgcggaggtggcggtggtggtcgcg
gactccgacggtcgtgccgaccggcgtggggcgactgtcatctcgatcggcgcggcgggt
gtggggcctttgcgtgtgacggagtacggcggtaagcggcaggaagagactttcaccgac
ctgatcgccgcggcggccgggatcatcctcgggcagcggggtcgtggggccccggtcgcc
gtcctgcgtggcgtcgcctacgagagcagtgacgcgggcgtggcgtcgatgcttcaacgc
cggccgtga

DBGET integrated database retrieval system