KEGG   Salinispora tropica: Strop_1166Help
Entry
Strop_1166        CDS       T00504                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
stp  Salinispora tropica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Strop_1166
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strop_1166
  Lipid metabolism
   00071 Fatty acid degradation
    Strop_1166
  Amino acid metabolism
   00350 Tyrosine metabolism
    Strop_1166
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Strop_1166
   00626 Naphthalene degradation
    Strop_1166
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Strop_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1306371..1307372
Genome map
AA seq 333 aa AA seqDB search
MQAYVQTKYGDPSVMRLMDVPTPTPEHGEVLIRVRAAGLNPVDYHIRDGKMRMIARMKLP
KVAGSELAGVVEAVGPGVTGLAVGDRVFTRVDVMKLGAFAPHAVVAADLVAPMPQSLDFT
EAAGLPLAGLTALQALRDELTIEKGQRIFISGGAGGVGTLAIQLAAWMGAQVATTASPGG
ENLVRSLGAETVINYQTTSFADVLRDYDAVLDLRGGQDLADSFAIVRPGAKVVSVAGVPE
RNSAKDLGAGPLVGALFNLLSGKVRRQAKAHGVTYRYLFMHPSGADLRILADLVDGGNLK
VVTDQVFPFEEIADAFARLERGHAKGKIIVAMP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcatacgtacagaccaagtacggcgacccgagcgtcatgcgactcatggacgtg
cccacgcccacgcccgagcacggtgaggtgctgattcgggtacgggcagcaggcctcaat
ccggtggactaccacatccgggacggcaagatgcggatgatcgcccggatgaaactgccg
aaggtggccggcagcgagctggcgggcgtggtggaagccgtcgggcccggcgtcaccggc
ctcgccgtcggggaccgggtgttcacccgcgtcgacgtcatgaagctgggcgccttcgcc
ccccatgcggttgtcgcggcggacctcgtcgccccgatgccgcagtcgctggacttcacc
gaggccgccgggcttcccctggccggcctcaccgcgctacaggccctgcgggacgagctc
accatcgaaaagggccaacggatcttcatctccggcggtgcgggtggcgtgggcacactc
gccatccaactcgcggcatggatgggcgcccaggtcgccacgaccgcctcgcccgggggt
gagaatctggtgcggtcactcggtgctgagacggtcatcaactaccagacgaccagcttc
gcagacgttttgcgggactacgacgcggttctcgacctccggggtggtcaggatctggcg
gacagtttcgccattgtccgtcccggagccaaggtggtgtccgtcgcgggagtgcccgaa
cggaactcagccaaggacctgggcgccggtccactggtcggtgccctgttcaacctgctc
agtggcaaggtccggcggcaggccaaggcgcacggggtcacctaccggtatctgttcatg
caccctagcggtgccgatctgcgaattctggccgacctcgtcgacggtgggaacctgaag
gtggtgacggaccaggtcttccccttcgaggagatcgcggacgccttcgcccgcctcgag
cgtggccacgccaagggaaagatcatcgttgcgatgccctga

DBGET integrated database retrieval system