KEGG   Salinispora tropica: Strop_1202Help
Entry
Strop_1202        CDS       T00504                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
stp  Salinispora tropica
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Strop_1202
Enzymes [BR:stp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Strop_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1354690..1355586
Genome map
AA seq 298 aa AA seqDB search
MPQTRVVVLGSANMDLVATAATLPRPGETLLGADFVMVPGGKGANQAIAAARAGAACTFL
GAIGSDAFGVTLRARITAAGVDTGHLRVAYGASGVALVMVNAEGENAIVVSPGANATMTG
LTESELTAVREADVLVAQLEIPVETVTEAAVAARAAGTRVVLNAAPARTVPAELFAATDV
LVVNESEAQTFTGHGRDKPQALLELTPRAVLTLGVSGAWYGDREGVQVHVPAVPVEAVDS
TAAGDAFSAALAVGWGEGRELVDAVRWATAAGAACARRLGTSVALPRRDEIDELYRPG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccacagacccgggtggtcgtcctgggcagcgccaacatggacctcgtggcgaccgcc
gcgacgctgccccgaccgggggagacactgctcggcgcggatttcgtcatggtgcccggc
ggcaagggcgccaaccaggccatcgcggcggcgcgggccggcgcggcctgtacctttctc
ggtgccatcggctccgacgccttcggcgttactctgcgtgcccgcatcaccgcggccgga
gtggacaccggacacctgcgggtcgcgtacggtgcctccggggtcgccctggtgatggtc
aacgccgagggggagaacgccatcgtggtcagtcccggcgccaacgccacgatgaccggg
ctgaccgagtcggagctgacggccgtacgcgaggcggacgtgctggtcgcccagctggag
atcccggtggagaccgttaccgaggcggcggtggcggcgcgtgccgccggcacccgcgtg
gtgctcaacgccgcgccggcccggaccgtgccggcggagctcttcgccgccaccgacgtg
cttgtggtcaatgagagcgaggcacagacgttcaccggtcacggtcgggacaagccgcag
gcgctactggagctgaccccccgggcggtgctcaccctcggcgtctccggcgcctggtac
ggcgaccgggagggcgtccaggtgcacgtcccggcggtgccggtcgaggcggtcgactcg
acggcggccggcgacgcgttctcggcagcgcttgcggtcggctggggcgaggggcgcgag
ctggtggacgcggtgcggtgggcgacggccgctggcgcggcgtgtgcccggcgactcggc
acttcggtggcgttgccccgccgggacgagatcgacgagctgtaccggccgggctga

DBGET integrated database retrieval system