KEGG   Salinispora tropica: Strop_1809Help
Entry
Strop_1809        CDS       T00504                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
stp  Salinispora tropica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:stp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Strop_1809 (ruvA)
Enzymes [BR:stp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Strop_1809 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2069050..2069652
Genome map
AA seq 200 aa AA seqDB search
MIASVRGVVTATGPDHAVLEVGGVGLAVQCAPGTIADLRVGQPARLATSLVVREDSLTLY
GFADDDAKALFELLQTASGVGPRLAQAVLAVHPPEAVRAAIANADTAALTRVPGIGKKGA
ERLVLELRDRIGPVPVGADSAAGVTTGAWPEQVRQALVGLGWTAAQADQAVTAVAETVDG
AVPPVPVLLRQAIRLLGRTR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccagtgtccggggcgtggtgaccgcgaccggtcccgaccacgccgtcctggag
gtcggcggggtgggcctggcggtgcagtgcgcgccgggcacgatcgccgacctgcgggtg
ggccagccggcccgcctcgccaccagcctggtcgtccgggaggattcgctgaccctctac
gggttcgccgacgacgacgccaaggctctgttcgagctcctgcagacggccagcggggtc
ggccctcgactggcccaggccgtcctcgcggtgcacccgccggaggcggtccgcgcggcc
atcgccaacgccgacaccgccgcgttgacccgggtgccgggcatcggcaagaagggcgcc
gagcggctcgtactggagctgcgggaccggatcggtccggtcccggtcggtgccgactcc
gccgccggcgtcacgaccggtgcctggccggagcaggtgcgtcaggccctggtcgggctc
ggctggacggcggcgcaggcggatcaggcggtcaccgcggtggcggagacggtggacggg
gcggtgcccccggtgccggtcctgctccgacaggcgattcggctgctgggtcggacccga
tga

DBGET integrated database retrieval system