KEGG   Salinispora tropica: Strop_1853Help
Entry
Strop_1853        CDS       T00504                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
stp  Salinispora tropica
Pathway
stp00240  Pyrimidine metabolism
stp00250  Alanine, aspartate and glutamate metabolism
stp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Strop_1853
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Strop_1853
Enzymes [BR:stp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Strop_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABP54315
JGI: Stro1853
UniProt: A4X615
Position
2118256..2119182
Genome map
AA seq 308 aa AA seqDB search
MIRHLLSSADLDAGTALQILDTAAEMATVAGREVKKLPALRGRTVVNLFYEDSTRTRISF
EAAAKRLSADVINFSVKGSSVAKGESLKDTALTLQAMGADAVVVRHPASGAPYQLADWVD
GSVVNAGDGTHEHPTQALLDAYTMRSRLGRLAGLSVAVVGDVLHSRVARSNVLLLSTLGA
KVTLVGPPPLIPVDIAAALAPSAAVCYDLDAVLPQSDVVMMLRVQRERMNDSYFPSAREY
ARRYGLDGSRMRRLPEHAIVMHPGPMNRGMEITSEVADSPRSTIVEQVANGVSVRMAVLY
LLLGGNNR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcacctgctctccagcgccgacctggacgctggtaccgccctccagatcctg
gacaccgccgccgagatggccaccgtggccgggcgggaggtcaagaagctgccggcgctg
cgcggtcggaccgtggtgaacctcttctacgaggactccacccggactcggatctccttc
gaggccgccgccaagcggctcagtgccgacgtgatcaacttttcggtcaaggggtccagc
gtcgccaagggtgagagtctgaaggacaccgcactcaccctccaggcgatgggcgccgac
gccgtcgtcgtccggcaccccgcctccggtgccccgtaccagctggccgactgggtcgac
ggctccgtcgtcaacgccggcgacggtacgcacgagcaccccacccaggcgctactcgac
gcgtacacgatgcgttcccggctgggccgactcgccggcctgtcggtggcggtggtcggt
gacgtgctgcacagccgggtggcacgctccaacgtcctgctgctctccaccctcggtgcc
aaggtcaccctggtcggtccgcctccgctgatcccggtggacatcgcggcggccctcgcg
cccagcgccgccgtctgctacgacctggacgcggtgctgccgcagtcggacgtggtcatg
atgctgcgggtgcagcgggagcgcatgaacgactcctactttccgtccgcccgtgagtac
gcccgccgttacggcctggacggctcacggatgcggcggctgccggagcacgcgatcgtg
atgcatcccggtccgatgaaccggggcatggagatcacctccgaggtggccgactcgccc
cgctccaccattgtcgaacaggtcgccaacggcgtctccgtccggatggccgtcctctac
ctgctactcggagggaacaaccggtga

DBGET integrated database retrieval system