KEGG   Salinispora tropica: Strop_2186Help
Entry
Strop_2186        CDS       T00504                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
stp  Salinispora tropica
Pathway
stp00860  Porphyrin and chlorophyll metabolism
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Strop_2186
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Strop_2186
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Strop_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 HI0933_like FAD_oxidored NAD_binding_9 FAD_binding_2 Pyr_redox Thi4 Trp_halogenase FAD_binding_3 MCRA
Motif
Other DBs
NCBI-ProteinID: ABP54637
JGI: Stro2186
UniProt: A4X6Y7
Position
complement(2474803..2476269)
Genome map
AA seq 488 aa AA seqDB search
MVDNKQDRADTTPHVVIVGGGITGVTAAFHLRTEPVRITLLEAAPRLGGKLSASEVAGVL
VDEGAEGLYARRPKTTRLITAAGLGDQLTLAGATTTAIWSRGALRPLPTSQFMGIPSDLD
ALAESGILSPEGVAEARRDLELPPTERDGDVSVAAYVSERLGQEVLDRLVDPFLSDVCAG
RPDQLSFEAMLAPLANASRRYPSLIRAAGSLVPPPPPDGQEAPTGIGTLTGGLGNLPQVL
VNAVLADSPHAQVRTGAEVTGLAPEQQGWRLTVNADAGTEHLTADAVILAVPAGPAGRLL
ADVPGAAPAAAELAQIPYASVGMITLAYPRTAFAGGLAARGFCGYRVPAVDGRAVNEVTF
STVKWPHLAGEVEILRCSVGQVGDEAPLHRDDADLVRLVAAEVAAATGAVGAPVATRVTR
WASALPQYTVGHLDRVNRIRTAVSGSPGLAVCGAAYEGVGVGTCIADARKAVDQVLVGLP
GTTVATLT
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggtggacaacaaacaggatcgggcagatacaacgccccacgtggtcatcgtcgggggc
ggcatcacgggggtgacggcagcgttccacctccggaccgagccagtacgaatcaccctc
ctcgaggccgcaccgcggctcggcgggaagctgtccgcctctgaggtggcgggcgtcctc
gttgacgagggggcggaagggctgtatgcccgacgtcccaagaccacgcggttgatcacc
gcggccggtctcggcgatcagctcacgctggccggcgccaccacgacagcgatctggagc
aggggtgcgcttcggcccctgcccaccagccagttcatgggcatcccctcggacctggac
gccctcgccgagtccggcatcctctcgccggagggggtcgccgaggcccgtcgtgacctc
gagctgccaccgaccgaacgggacggcgacgtctccgtcgcggcctacgtctcggaacga
ctcggccaggaggtactggaccgcctcgtcgacccgttcctcagcgacgtctgcgccggc
cgccccgaccagctgtcgttcgaggccatgctggccccgctggcgaacgcgtcccgcagg
tacccgtcgctgatccgggccgcgggctcgctggtcccgccgccaccaccggacggtcag
gaagccccgaccgggatcggcacgctgaccggtgggctcggaaacctgccccaggtactg
gtcaacgccgttctcgccgactcaccccacgcgcaggtacggaccggggccgaggtcacc
ggcctggctccggaacagcaggggtggcggctgaccgtcaacgccgacgccgggacagag
cacctcaccgcggacgcggtcatcctcgccgtccccgccgggcccgccgggcggctgctg
gccgatgtacccggagcggctccggccgccgccgagctcgcgcagatcccgtacgccagt
gtcggcatgatcacgctggcgtacccgcgtacggcattcgccggcgggctcgccgcgcgc
gggttctgcggctaccgcgttccggcggtagacggacgggccgtcaacgaggtgaccttc
tcgacggtgaagtggccgcacctggcgggcgaggtggagatcctgcgctgctcggtcggg
caggtcggcgacgaggcaccgctgcaccgcgacgacgccgacctcgtccggctggtggcc
gccgaggtcgccgcggccaccggggcggtcggtgctccggtggcgacccgggttacccgg
tgggcgagcgcgctgccccagtacacagtcggccacctggatcgggtgaaccgaatccgg
acggcggtgagtggctcgccggggctcgccgtctgcggtgccgcgtacgagggagtgggg
gtcggcacgtgcatcgccgacgcgcgtaaagccgttgaccaggtgctcgtggggctaccc
ggaaccaccgtcgccaccttgacctga

DBGET integrated database retrieval system