KEGG   Salinispora tropica: Strop_2217Help
Entry
Strop_2217        CDS       T00504                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K16438  
epimerase EvaD
Organism
stp  Salinispora tropica
Pathway
Biosynthesis of vancomycin group antibiotics
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    Strop_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2509873..2510484
Genome map
AA seq 203 aa AA seqDB search
MKVEKLAVQGAFVFTPEVFSDHRGLFVSPFQRLSFTAANGGPILPVAQTNHSMSRRGVVR
GVHYTSTPPGVAKYVYCAVGEAIDIIVDVRVGSPTFGTWDAVQMNSQEFRAMYFPVGVGH
AFVSLADGTVMSYMLTGSYVPEHERVVSAFDPALGLPIPTDLETIISDRDRVGPSLAETA
EAGLLPDYQQCQVLEHQLYRVAH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgagaagctcgcggtccagggtgcgttcgtgtttactcctgaggtgttctcg
gaccaccgcggactgttcgtgtcaccattccagcgattgtcgttcacggcggcgaacgga
ggcccgatcctgcccgtcgcacagaccaaccacagcatgtcccggcggggtgtggttcgc
ggagtccactacaccagcactccgccgggtgtggcgaagtacgtctactgtgctgtcggt
gaggcgatcgacatcatcgttgacgtccgagtcggttcaccgacattcggcacctgggac
gcggtgcagatgaactcgcaggagttccgggcgatgtactttccggtcggggtcgggcac
gccttcgtgtcactcgcggacggcaccgtcatgtcctacatgctcacggggtcgtacgtc
ccggagcacgagcgggtggtctccgccttcgaccccgctctggggctgccgatccccacg
gacctggagacaatcatctccgatcgggaccgggttggtccgagcctggccgagaccgcc
gaggccggtctccttcccgactaccagcagtgccaggtcctggagcaccagctctatcgg
gtggcccactga

DBGET integrated database retrieval system