KEGG   Salinispora tropica: Strop_2217Help
Entry
Strop_2217        CDS       T00504                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
stp  Salinispora tropica
Pathway
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Strop_2217
   01055 Biosynthesis of vancomycin group antibiotics
    Strop_2217
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    Strop_2217
Enzymes [BR:stp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     Strop_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2509873..2510484
Genome map
AA seq 203 aa AA seqDB search
MKVEKLAVQGAFVFTPEVFSDHRGLFVSPFQRLSFTAANGGPILPVAQTNHSMSRRGVVR
GVHYTSTPPGVAKYVYCAVGEAIDIIVDVRVGSPTFGTWDAVQMNSQEFRAMYFPVGVGH
AFVSLADGTVMSYMLTGSYVPEHERVVSAFDPALGLPIPTDLETIISDRDRVGPSLAETA
EAGLLPDYQQCQVLEHQLYRVAH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcgagaagctcgcggtccagggtgcgttcgtgtttactcctgaggtgttctcg
gaccaccgcggactgttcgtgtcaccattccagcgattgtcgttcacggcggcgaacgga
ggcccgatcctgcccgtcgcacagaccaaccacagcatgtcccggcggggtgtggttcgc
ggagtccactacaccagcactccgccgggtgtggcgaagtacgtctactgtgctgtcggt
gaggcgatcgacatcatcgttgacgtccgagtcggttcaccgacattcggcacctgggac
gcggtgcagatgaactcgcaggagttccgggcgatgtactttccggtcggggtcgggcac
gccttcgtgtcactcgcggacggcaccgtcatgtcctacatgctcacggggtcgtacgtc
ccggagcacgagcgggtggtctccgccttcgaccccgctctggggctgccgatccccacg
gacctggagacaatcatctccgatcgggaccgggttggtccgagcctggccgagaccgcc
gaggccggtctccttcccgactaccagcagtgccaggtcctggagcaccagctctatcgg
gtggcccactga

DBGET integrated database retrieval system