KEGG   Salinispora tropica: Strop_2285Help
Entry
Strop_2285        CDS       T00504                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
stp  Salinispora tropica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Strop_2285
Enzymes [BR:stp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Strop_2285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2578492..2579880
Genome map
AA seq 462 aa AA seqDB search
MKLGMRTVALAGVLAVVAAGALVASATATAAAAPAATFVKVSDWGSGWEGRYTITNGGSS
TLNSWQVEFDLPAGTSVGSYWNALMDRDGQRYRFTNQHWNGTIAPGSSVTFGFLGAGPGS
PSGCQLDGQPCEPTAPPTTSPPPPPPTTAPPGSTPVAANGQLRVCGEQLCNENGKPIQLR
GMSTHGLQWYANCATSASLDVLAQQWGADVLRISMYIQEGGYETDPRGFTDLVHDYIEMA
TARGLYAIVDWHMLTPGDPNDNLSRAQTFFAEIADRHRDKVNVLYEIANEPNGVNWSAVK
SYADQVIPVIRERDPESVVLVGTPDWSSLGVSGSGGGVDAITANPVSASNLMYVFHFYAA
SHGDLYYNTLAAAADRIPIFVTEFGTQQYTGDGPNDFTMSQRYLDLMASKKISWVNWNYS
DDFRSGAVFTTGTCASGDFGGTGPLKPAGSWIRDRMRTADDF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggcatgaggactgtggccctggcgggcgtcctcgcggtggtggccgcgggg
gccctggtggccagcgccaccgcgaccgcggcggccgcaccggccgcgacgttcgtcaag
gtttccgactggggtagtggctgggaaggccgatacaccatcaccaacgggggaagcagc
accctgaactcctggcaggtcgagttcgacctaccggcgggcacgagcgtcggctcgtac
tggaacgcgttgatggaccgcgacggacagcgctaccgcttcaccaaccagcactggaac
ggcacgatcgcaccgggctcctcggtgacgttcggcttcctcggcgccggcccgggcagc
ccgagcggttgccagctcgacggccagccgtgcgagccgacagctcctccgacgaccagc
ccacccccaccaccaccgaccaccgcgcctcccggtagcacaccggttgcggcgaacggg
caactgcgggtctgtggtgagcagctgtgtaacgagaacggcaagccgatccaactgcgc
ggcatgagcacgcacggtcttcagtggtacgccaactgcgcgaccagcgcctcgctcgac
gtcctcgcccagcagtggggcgccgacgtcctgcggatctcgatgtacatccaggaaggc
ggctacgagaccgacccgcgtggcttcaccgatcttgtccatgattacatcgagatggcc
accgctcgcggtctctacgcgatcgttgactggcacatgctcacgccgggagatccgaac
gacaacctgtcgcgcgcgcagaccttcttcgccgagatcgccgaccgccaccgggacaag
gtgaacgtgctctacgagatcgcgaacgagccgaacggtgtcaactggagcgcggtcaag
agctacgccgaccaggtcatcccggtcatccgggaacgggacccggagtccgtggtgctc
gtcggcacccccgactggtcgtcgctcggtgtctccggaagtggcggcggcgttgacgcc
atcaccgccaacccggtgtcggcaagcaacctcatgtacgtcttccacttctacgcggcc
tcgcacggcgacctgtactacaacaccctggcggcggcggctgaccgaatcccgatcttc
gtgaccgagttcggcacccagcagtacaccggtgacggtccgaacgacttcaccatgtcc
cagcgttacctcgacctgatggcgagcaagaagatcagttgggtcaactggaactactcc
gacgatttccgctccggcgcggtcttcaccacaggaacgtgcgccagcggcgacttcggc
ggtacgggcccgctcaagccggccggtagctggattcgcgaccgcatgcgtaccgctgac
gacttctga

DBGET integrated database retrieval system