KEGG   Salinispora tropica: Strop_2394Help
Entry
Strop_2394        CDS       T00504                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
stp  Salinispora tropica
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Strop_2394
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Strop_2394
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Strop_2394
Enzymes [BR:stp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Strop_2394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2687715..2689337
Genome map
AA seq 540 aa AA seqDB search
MTNTLDRRTLLRVAGASAGTAVFASTVLAGPAGATGSAFRHGVASGDPLPDGILLWTRLT
PTEDSQPGSGVGPEATVTWQVATDPDFATLAAQGTLVTSPDRDHTVKVPVSGLAPATTYW
FRFGYADAWSPTGRTMTAPEADADIDRIRLGVVSCSNWEAGYFAAYRHLAERGDLNLVVH
LGDYLYEYGTGEFPAGDTVVRSVQPAHETLTLQDYRVRHALYKSDPDLQALHASVPWAIT
WDDHEVANDQWSGGAENHTPGTEGSFSDRVAQARQAYAEWMPVRTGADGAIYRRLRFGRL
ADLSMLDLRTYRSEQASGLAIDDPERTITGEAQMAWLKAGLATSDAQWKLVGNPVMISRL
DVGALPSWLLGPLGTLLGIPQNGAVLNADQWDGYNADRNELIDHLLATDTRDVVFLTGDI
HTSWANELTTQSTGLTNPAAAEFVVPSVTSDNINDFLGLQEGNVLSDLASGLIRSTNPHV
RWTELDGHGYGVLEVTPQQCRMDWFHLVDRTQSSTGSRFVTGWSVTAGSARLRRESAPLS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaccctcgaccgtcgtaccctcctgcgtgtcgccggcgcctccgccggcaca
gccgtcttcgccagcaccgtcctcgccggaccggccggggctaccggtagcgccttccgg
cacggcgtcgcctccggtgacccgttgcccgatgggatcctgctctggacccggctcacc
ccgaccgaggactcccagcccggttcgggagtcggcccggaggcgacggtgacctggcag
gtggccaccgacccggatttcgcgacactcgcggcacagggcaccctcgtcaccagcccg
gaccgggatcacacggtcaaggttcccgtcagcgggctagcgccagccaccacgtactgg
ttccgcttcggctacgccgacgcctggtcacccaccggccggacgatgaccgcgccggag
gcggacgctgacatcgaccgaatccgactgggtgtggtgtcctgttcgaactgggaggcg
ggctacttcgccgcctaccggcacctcgccgagcgcggcgacctgaatctcgtggtgcac
ctcggcgactacctctacgagtacggcaccggagagttccccgccggggacaccgtggtg
cggtcagtccaaccggcgcacgaaacgctgaccctgcaggactaccgcgtccgacacgcg
ctctacaagagcgatcccgatctgcaggccctgcacgcgtcggtgccgtgggcaatcacc
tgggacgaccacgaggtcgccaacgaccagtggtcgggcggtgcggagaaccacactccc
ggcaccgagggcagcttcagcgatcgggtggcgcaagcacgccaggcctacgcggagtgg
atgccggtgcgcaccggggcggacggcgcgatctatcggcggttgcgcttcggccggctc
gccgacctgtccatgttggacctgcggacgtaccgctccgaacaggcatccggtctggcc
attgacgacccggagcggacgatcaccggcgaggcgcagatggcctggctgaaggcgggc
ctggctacctcggacgcccagtggaagctggtcggcaaccccgtcatgatctcccggctg
gatgtgggtgcccttccctcctggctgctcgggccgctgggcacgttgctcggcattccg
cagaacggcgcggtgctcaacgccgaccagtgggacggctacaacgccgaccgcaacgag
ctgattgaccacctgttggcgactgacacccgggatgtggtcttcctgaccggcgacatc
cacacctcgtgggcgaacgagctgaccacgcagtcgaccgggctgaccaacccagctgct
gcggagttcgtggtgccgtcggtgaccagtgacaacatcaacgacttcctggggctgcag
gaaggcaacgtactcagtgatctcgcgtcgggcctgatccgctcaaccaacccgcacgtg
cgctggaccgagttggacgggcacggctacggggtgctggaggtgacgccgcagcagtgc
cggatggactggttccacctggtcgaccggacccagagcagcaccggcagccgctttgtg
acgggctggtcggtgaccgccggctcggcacggctacgccgggagagcgcgccgctgagc
tga

DBGET integrated database retrieval system