KEGG   Salinispora tropica: Strop_2426Help
Entry
Strop_2426        CDS       T00504                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
stp  Salinispora tropica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2721794..2722939
Genome map
AA seq 381 aa AA seqDB search
MTATAERARNRLVHELTGHGWLTEAWRTAFAAVPRHLFLTRFFRQTPDRSRYEAVDVNDL
GALELIYSDRVLPTQLDGDDARWDESRHHGPLAGVPTCSSTQPALMAVMLDALDVADGHR
VLEVGTGTGYNAALLAHRLGSPLVTTVDIDAGLVRRARQSLTSVGYAPTVAATDGEAGYP
GNAPYDRIIAACSVPQVPTGWLAQSRPGGVILTSLHREIGGGLLLRLTVDETGTASGHLL
DDYGSFMPLRSCPTVRTSALVRAASQATGDRHKTHLPGPLADDGEAWTALVALLLPDVAR
LDLGRPEGPVQWLVHPDGSWAYHDISTQTVEQGGPRRLWTEVEDLYSRWTAHGKPSRSHI
GVTITPAGQQVWLNDPTEIIG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccgccgaacgggcgcgcaaccggctcgtgcacgagctgaccggccacggc
tggctcaccgaggcgtggcggacggcgtttgccgccgtgccccgccacctgttcctaacc
cgcttcttccgccagaccccagaccgcagcaggtacgaagcggtcgacgtgaacgatcta
ggggcactggagctgatctactccgaccgcgtgctccccacccagctcgacggcgacgac
gcccgctgggacgagtctcggcaccacggcccgctcgccggcgtgccgacctgctccagc
acccagccggccctcatggccgtcatgctggacgcgctcgacgtggccgacgggcaccgc
gtgctggaggtcggcaccggcaccgggtacaacgcggcgcttctggcgcaccggctcggc
tcgccgctggtcaccaccgtcgacatcgacgccggactggtgcggcgggcgcggcagtcg
ttgacctccgttggctacgcccccacggtggccgccaccgacggcgaggccggctatccc
ggcaacgccccctacgaccggatcatcgccgcctgttcggtgccacaggtgccgacgggc
tggctcgcacagtcccgccccggcggggtgatcctgaccagcctgcaccgcgagatcggc
ggtgggctgctgctgcggctaaccgtggacgagaccggcacggccagcgggcacctgctc
gacgactacggctcgttcatgccgctgcgctcctgccccaccgtgcgaacctcggcgctc
gtccgcgccgcctcccaggccaccggggacaggcacaagacccacctgcccggcccgctg
gccgacgacggcgaggcgtggaccgcactggtggcgctgctgctacccgacgtggcccgc
ctcgacctcggccgtccggaggggccggtgcagtggcttgtccacccggatggttcgtgg
gcgtaccacgacatctccacccagacggtggaacagggcggaccgcgtcggctgtggacc
gaggtggaggacctctacagccggtggaccgcacacggcaagcccagccgctcacacatc
ggtgtgactatcacccccgccgggcagcaggtctggctcaacgaccccaccgagatcatc
ggctga

DBGET integrated database retrieval system