KEGG   Salinispora tropica: Strop_2426Help
Entry
Strop_2426        CDS       T00504                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
stp  Salinispora tropica
Brite
Enzymes [BR:stp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Strop_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 MTS Methyltransf_23 DUF938 Methyltransf_11 PrmA RrnaAD Methyltransf_12 CMAS
Motif
Other DBs
NCBI-ProteinID: ABP54873
JGI: Stro2426
UniProt: A4X7M3
Position
2721794..2722939
Genome map
AA seq 381 aa AA seqDB search
MTATAERARNRLVHELTGHGWLTEAWRTAFAAVPRHLFLTRFFRQTPDRSRYEAVDVNDL
GALELIYSDRVLPTQLDGDDARWDESRHHGPLAGVPTCSSTQPALMAVMLDALDVADGHR
VLEVGTGTGYNAALLAHRLGSPLVTTVDIDAGLVRRARQSLTSVGYAPTVAATDGEAGYP
GNAPYDRIIAACSVPQVPTGWLAQSRPGGVILTSLHREIGGGLLLRLTVDETGTASGHLL
DDYGSFMPLRSCPTVRTSALVRAASQATGDRHKTHLPGPLADDGEAWTALVALLLPDVAR
LDLGRPEGPVQWLVHPDGSWAYHDISTQTVEQGGPRRLWTEVEDLYSRWTAHGKPSRSHI
GVTITPAGQQVWLNDPTEIIG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaccgccgaacgggcgcgcaaccggctcgtgcacgagctgaccggccacggc
tggctcaccgaggcgtggcggacggcgtttgccgccgtgccccgccacctgttcctaacc
cgcttcttccgccagaccccagaccgcagcaggtacgaagcggtcgacgtgaacgatcta
ggggcactggagctgatctactccgaccgcgtgctccccacccagctcgacggcgacgac
gcccgctgggacgagtctcggcaccacggcccgctcgccggcgtgccgacctgctccagc
acccagccggccctcatggccgtcatgctggacgcgctcgacgtggccgacgggcaccgc
gtgctggaggtcggcaccggcaccgggtacaacgcggcgcttctggcgcaccggctcggc
tcgccgctggtcaccaccgtcgacatcgacgccggactggtgcggcgggcgcggcagtcg
ttgacctccgttggctacgcccccacggtggccgccaccgacggcgaggccggctatccc
ggcaacgccccctacgaccggatcatcgccgcctgttcggtgccacaggtgccgacgggc
tggctcgcacagtcccgccccggcggggtgatcctgaccagcctgcaccgcgagatcggc
ggtgggctgctgctgcggctaaccgtggacgagaccggcacggccagcgggcacctgctc
gacgactacggctcgttcatgccgctgcgctcctgccccaccgtgcgaacctcggcgctc
gtccgcgccgcctcccaggccaccggggacaggcacaagacccacctgcccggcccgctg
gccgacgacggcgaggcgtggaccgcactggtggcgctgctgctacccgacgtggcccgc
ctcgacctcggccgtccggaggggccggtgcagtggcttgtccacccggatggttcgtgg
gcgtaccacgacatctccacccagacggtggaacagggcggaccgcgtcggctgtggacc
gaggtggaggacctctacagccggtggaccgcacacggcaagcccagccgctcacacatc
ggtgtgactatcacccccgccgggcagcaggtctggctcaacgaccccaccgagatcatc
ggctga

DBGET integrated database retrieval system