KEGG   Salinispora tropica: Strop_2675Help
Entry
Strop_2675        CDS       T00504                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
stp  Salinispora tropica
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Strop_2675
Enzymes [BR:stp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Strop_2675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3009371..3010957)
Genome map
AA seq 528 aa AA seqDB search
MTEEWDQTADVVVVGFGAAGACAAVEAADAGAHVLALDRFSGGGTTAMSGGVIYAGGGTR
QQRAAGVTDTPQAMLDYLHAEVGDTVSPATLRRFCEQSADAIDWLAGLGVPFESSLCPYK
TSYPTNRHYLYYSGSEHSFAHLAPPAPRGHRVHARGTSGRLLAARLAAATRDRGVGLLPQ
TRVERLVTGPDGRVTGVECRTLRGATRWVRLAHRLLHRCSVRPGVYLPALGRALHRPVAW
LERRYGRRLRVRAAGGVVLCAGGFVFDREMLRTHAPEYRGGLRLGTPGDDGSGIRLGVAA
GADTAHLDRVSIWRFIAPPAEMLGGLLVDRDGRRICDESRYGAAVGEAILRSPDARAWLL
LDAALRSECRRQLRAQTLWFQRWQARWLLTFGRVTAATPEAVARRAGVSPEQLADTLAAY
QAGGPDPAGKPADQVRPLAVPPYSLVDVSVRSRLVAPAPMLTLGGLRVDEETGQTLGADG
SGVPGLYAAGRTAVGVCSRSYVSGLSLADCVFSGRRAGRSAAIRGREG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaggagtgggaccagacggctgacgtcgtggtggtcggcttcggcgcggccgga
gcctgtgccgccgtcgaggccgccgacgcgggtgcgcacgtcctggcgcttgaccggttc
tccggcggcggtaccaccgcgatgtccggcggggtgatctacgccggcggcggcactcgg
cagcagcgcgcggccggggtcaccgacacaccccaggcgatgctggactacctgcacgcg
gaggtcggcgacaccgtctctcctgcgaccctgcgccggttctgcgagcaaagcgccgac
gcgatcgactggttggccgggctcggcgtgccgttcgagtcgagcctctgtccctacaag
acctcatacccgaccaatcggcactacctgtactactccggcagcgagcattccttcgcc
catctcgcgccaccggcgccacgcggccaccgggtgcacgcccgcggcacctccggtcgg
ttgctcgcggcccggctcgccgctgccacccgcgaccgtggcgtcgggctactcccgcag
acccgtgtcgagcggctcgtcaccggtcccgacggccgggtcaccggagtcgagtgccgg
accctgcgcggtgccacgagatgggtccgccttgcccaccgtctcctgcaccgttgctcg
gtccggcccggtgtctacctaccggccctgggtcgcgcgctgcaccggccagtcgcctgg
ctggagcggcggtacggtcgtcggctgcgggtccgggcggccggtggtgtcgtgctctgc
gccggcgggttcgttttcgaccgcgaaatgcttcgtacccacgcgccggagtaccgcggt
ggcctgcggctgggcacgcccggcgacgacggttccggtatccggctcggcgtggcggcc
ggcgcggacaccgctcacctcgaccgggtgagcatctggcgattcatcgccccgcccgcg
gagatgctcggcggcctactcgtcgaccgggacggccgacggatctgcgatgagtcgcgc
tatggcgcggccgtcggtgaggcgatcctgcgctcgccggatgcgcgggcctggctgctg
ctcgacgcagcgttgcggtccgagtgccgccggcagcttcgggcccagaccctgtggttc
caacgatggcaggcgcggtggttgctgacgttcggtcgggtcaccgcggcgacaccagag
gcggtcgcgcgtcgcgccggagtgagtcccgagcaactggccgacactctagcggcctat
caggcgggtgggcccgacccggccggcaagcccgccgaccaggttcggcccctggccgtc
ccgccgtactcgctggtcgatgtctcggtgcggtcccggctcgttgcgcccgcacccatg
ctcaccctcggtggcctccgggtggacgaggagaccgggcagaccctgggggccgacggc
agtggtgtacccggcctgtatgccgccggtcgtaccgcggtcggcgtctgctcgcgtagc
tatgtcagtgggctgtcgttggccgactgtgtcttctcgggccgacgggcaggccggagc
gccgcgatccggggccgggaggggtga

DBGET integrated database retrieval system