KEGG   Salinispora tropica: Strop_3170Help
Entry
Strop_3170        CDS       T00504                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
stp  Salinispora tropica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_3170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strop_3170
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strop_3170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3640975..3641778)
Genome map
AA seq 267 aa AA seqDB search
MSRIGVAFDQARAEGRAVLVGCMPAGFPTVEGSIAAMTAMVEAGVDVIEVEIPYSDPVMD
GPVIQRASDVALAGGVRVADTLRIVEAVAATGAPVVTMTYWNPVEQYGVDAFARDLAAAG
GTGLITPDLIPDEAQEWLAASDAYGLDRTFLVSPSSTDARLHMTVEQCRGFVYATTIMGV
TGARAQASAAAPVLVSRVRAVTDLPVGVGLGIGTGEQASTASSFADGVIVGSALIRRLLD
APNLPAGLTALRELSAELAAGVRTPAP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcgcatcggggtcgcgttcgaccaggctcgggccgagggccgagccgtcctggtc
ggctgtatgcccgccgggttcccgaccgtcgagggcagcatcgccgcgatgaccgccatg
gtcgaggcgggcgtggacgtcatcgaggtggagattccgtactctgatccggtgatggac
ggtccggtcatccaacgggccagtgatgtcgccctggccggcggtgtccgagtcgccgac
acgctgcgcatcgtcgaggcggtcgccgccaccggcgcgcccgtggtgacgatgacctac
tggaacccggtcgagcagtacggcgttgacgccttcgcccgggatctcgccgcagcgggc
ggcaccgggctgatcacgcccgacctgattcccgacgaggcgcaggagtggctggccgcc
tccgacgcgtacgggctggaccggaccttcctcgtctcgccctcctccactgacgctcgg
ctgcacatgaccgtcgagcagtgccgggggttcgtgtacgcgactacgatcatgggagtc
acgggggcccgtgcgcaggcctcggcggcggctccggtgctggtgtcccgcgtccgggcg
gtcaccgacctgccggtcggcgttggcctcgggatcggcaccggagagcaggccagtacg
gcttcctcgttcgctgacggtgtcatcgtcggcagtgccctcatccgccgcctgctcgat
gctccgaatctgccggcgggcctgaccgccctgcgtgagctgagcgccgaactcgccgct
ggcgtccggactccggccccctga

DBGET integrated database retrieval system