KEGG   Salinispora tropica: Strop_3171Help
Entry
Strop_3171        CDS       T00504                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
stp  Salinispora tropica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Strop_3171
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Strop_3171
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Strop_3171
Enzymes [BR:stp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Strop_3171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3641783..3643015)
Genome map
AA seq 410 aa AA seqDB search
MSVHTPAVTAHYPDATGHFGRFGGRFVPEALVAALDELDDAWRTAMGDEPFQTEFAALLR
DYAGAPSLLYTARRLSAKIGAQVLLKREDLNHTGAHKVRNVLGQALLTKRMGKRRVIAET
GAGQHGVATATAAALFDLECVVYMGEVDTQRQALNVARMRMLGATVVPVTTGSRTLKDAM
NEAMRDWVANVDSTHYLIGTAAGPHPFPALVRDFVRGIGDEARQQCLDLVGALPDAVTAC
VGGGSNALGVFHAFVDDPSVRLYGFEAGGDGPATGRHAASITGGTSGVLHGTRTYVLQDA
DGQTIESHSISAGLDYPGVGPEHAWLHDTGRATYRPVTDADAMAAFELLCRTEGIIPAIE
SSHALAGTVAIAPELAAELGREPVVVVNLSGRGDKDVHTAGGYFGVLDKE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccacacgcccgctgttaccgcccattatccggacgccaccggccatttcggc
cgtttcggcggccggttcgtccccgaggccctggtggccgcgttggacgagctcgacgac
gcctggcgtaccgcgatgggggacgagccgttccagaccgagttcgccgccctgcttcgc
gactacgccggcgccccctcgttgctctacaccgcccggcgcctctccgccaagattggc
gcccaggtgctgttgaagcgggaggacctcaaccacaccggggcgcacaaggtgcgcaac
gtgctcggccaggcgttgttgacgaagcggatgggcaagcggcgcgtcatcgccgagact
ggcgccggtcagcacggggtggccaccgccaccgctgccgccctgttcgatctcgagtgt
gtggtctacatgggtgaggtggacacccaacggcaggcgctgaacgtggcgcgcatgcgg
atgctgggcgccaccgtggtgccggtcaccaccgggtcacgcaccctcaaggacgcgatg
aacgaggcgatgcgggactgggttgccaacgtcgacagcacccactacctgatcggtacg
gccgccggcccgcaccccttccccgccctggtccgcgacttcgtccgcggcatcggcgac
gaggcccgccagcagtgtcttgacctggtcggtgcgctgcccgacgcggtcaccgcctgc
gtcggcggcggctccaacgcgctcggtgtcttccacgccttcgtcgacgacccgagcgtg
cgcctgtacggcttcgaagccggcggggacgggccggcgaccggtcggcacgcggccagc
atcactggtggcacttcgggggtgctgcacgggacccggacctacgtgcttcaggacgcc
gacggtcagaccatcgagtcgcactcgatctcggccggattggactacccgggggtcggg
ccggaacatgcctggctgcacgacacgggccgggcgacgtaccggccggtgaccgacgcc
gacgcgatggccgccttcgaactgctctgccggaccgagggcatcatccccgcgatcgag
agttcgcatgcgctggccggcacggtcgcgatcgccccggaactcgccgccgagttgggc
cgggagccggtcgtggtggtcaacctctccggccgtggcgacaaggacgtgcacaccgcc
ggggggtacttcggcgtccttgacaaggagtga

DBGET integrated database retrieval system