KEGG   Salinispora tropica: Strop_3267Help
Entry
Strop_3267        CDS       T00504                                 

Definition
6-phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
stp  Salinispora tropica
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strop_3267
   01230 Biosynthesis of amino acids
    Strop_3267
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strop_3267
   00030 Pentose phosphate pathway
    Strop_3267
   00051 Fructose and mannose metabolism
    Strop_3267
   00052 Galactose metabolism
    Strop_3267
  Energy metabolism
   00680 Methane metabolism
    Strop_3267
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Strop_3267
Enzymes [BR:stp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Strop_3267
Protein phosphatases and associated proteins [BR:stp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Strop_3267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3748976..3750004)
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVANYGHEFVGFRDGWKGPLEGLSRPLGIAEVRGI
LPRGGTILGSSRTNPFKIENGVERIKENLATQGVDALIAIGGEDTLGVATKLHELGVNVI
GVPKTIDNDLGATDYTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERQFDVNQVAGYVEKRFQHQYAPIVVVAEGAHPLEGQMVLHNQELDAF
GHVRLGGVGQWLAEQLEAKTGKEARTVVLGHIQRGGTPTAFDRVLATRLGLQAIDAVHEG
DWGKMVAMQSTDIVRVPLAEATRELKTVPLERYAEAEVFFGS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctcaccggcggtggcgactgccccggtctcaacgcggtcatccgg
gcggtggttcggaagggcgtggccaactacggtcacgagttcgtgggcttccgggatggc
tggaagggcccgctcgagggtctttctcgcccgctgggaatcgcggaggtacggggtatc
ctgccgcgcggcggcaccatcctgggctcctcccggaccaacccgttcaagatcgaaaat
ggcgttgagcggatcaaggagaacctcgccacccagggcgttgacgcgctgatcgcgatc
ggtggcgaggacaccctcggcgtggccacgaagctgcacgaactcggcgtcaacgtcatc
ggcgtaccgaagacgatcgacaacgacctgggcgccaccgactacaccttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccgactgcacaccaccgccgagagccac
caccgcaccctggtggtcgaggtgatgggtcggcacgctggctggattgcgctgcacgcc
gggctcgccggtggcgccaacgtgatcctgctgccagagcggcagttcgacgtgaaccag
gtcgccggttacgtcgagaagcgtttccagcaccagtacgccccgatcgtcgtggtcgcc
gagggcgcccacccgctcgagggccagatggtcctgcacaaccaggagctggatgccttc
ggccacgtccgcctcggtggcgtcggccagtggcttgccgagcagctcgaagccaagacc
ggcaaggaagcccgtaccgtcgtactcggccacatccagcgcgggggcaccccgaccgcc
ttcgaccgggtgctcgccacccggctcggtctccaggcgatcgacgcggtgcacgagggc
gactggggcaagatggtggcgatgcagagcacggacatcgttcgcgtgccgctggccgag
gccacccgtgagctgaagaccgtgccgctggagcggtacgccgaggccgaggtcttcttc
ggtagctga

DBGET integrated database retrieval system