KEGG   Salinispora tropica: Strop_3274Help
Entry
Strop_3274        CDS       T00504                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
stp  Salinispora tropica
Pathway
stp00010  Glycolysis / Gluconeogenesis
stp00052  Galactose metabolism
stp00500  Starch and sucrose metabolism
stp00520  Amino sugar and nucleotide sugar metabolism
stp00521  Streptomycin biosynthesis
stp01100  Metabolic pathways
stp01110  Biosynthesis of secondary metabolites
stp01120  Microbial metabolism in diverse environments
stp01130  Biosynthesis of antibiotics
stp01200  Carbon metabolism
Module
stp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Strop_3274
   00052 Galactose metabolism
    Strop_3274
   00500 Starch and sucrose metabolism
    Strop_3274
   00520 Amino sugar and nucleotide sugar metabolism
    Strop_3274
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Strop_3274
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Strop_3274
Enzymes [BR:stp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Strop_3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG DUF1464 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABP55708
JGI: Stro3274
UniProt: A4X9W8
Position
complement(3757024..3757971)
Genome map
AA seq 315 aa AA seqDB search
MTLTIGVDVGGTKVAAGVVDDTGTVLVQTRRDTPADDVGKTCDVIVEVIRELAEGRAIEG
VGIGAAGWIDASRSTVLFAPNLAWRDEPLREFVSGATDLPVIVENDANVAAWAEFRYGAA
CDAEDSMVMFTIGTGVGGGIVLGGELVRGAHGIAAELGHMLSVPDGHQCGCGRLGCIEQY
ASGSALVRLARAAARQEPHRATALLKCAGGDVDAITGRMVTAAAQDGDPVSTEAFAQVGH
WLGSGLADMAQILDPQVLVVGGGVVEAGDLLLGPARTSFTAALAQRGRLPVAQICPAKLG
NNAGLIGASDLARRI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccatcggagtggacgtcggtggcacgaaggtcgcggccggcgtcgtggac
gacacgggcacggtgctcgtgcagacccgacgggacactcccgcggatgatgtcggcaag
acctgcgacgtcatcgtcgaggtgatccgagagcttgccgagggccgggcgatcgaggga
gtcggcatcggggcggccggctggatcgacgccagtcgctcaaccgtactcttcgccccg
aacctcgcctggcgtgacgagccgctgcgcgagttcgtcagcggagccaccgacctgccg
gtgatcgtggagaacgacgccaacgtggcggcctgggcggagttccgctacggcgcggcc
tgcgacgccgaggactcgatggtcatgttcaccatcggcaccggggtcggtggtggcatc
gtgctcggcggcgagctggtacgtggcgcgcacggcatcgccgccgaactgggacacatg
ctctccgtgccggacgggcaccagtgcggctgcggccggttgggctgcatcgagcagtac
gccagcgggagcgctctggtgcggctcgcccgagccgcagcccgccaggaaccgcaccgc
gccaccgcccttctgaagtgtgccggcggcgacgttgacgcgataaccggccggatggtc
accgccgcggcgcaggacggcgacccggtctccaccgaggcgttcgcccaggtcggccac
tggctcggcagcggcctcgccgacatggcgcagatcctggacccgcaggtgttggtggtc
ggcggtggcgtcgtcgaagccggtgacctgctgctgggaccggcccgcacctccttcacc
gcggcgctcgcgcagcggggtcggctgccggtggcgcagatctgccccgccaaactcggc
aacaacgccggtctcatcggcgcctccgacctcgcccgtcggatctag

DBGET integrated database retrieval system