KEGG   Salinispora tropica: Strop_3274Help
Entry
Strop_3274        CDS       T00504                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
stp  Salinispora tropica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:stp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:stp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:stp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:stp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3757024..3757971)
Genome map
AA seq 315 aa AA seqDB search
MTLTIGVDVGGTKVAAGVVDDTGTVLVQTRRDTPADDVGKTCDVIVEVIRELAEGRAIEG
VGIGAAGWIDASRSTVLFAPNLAWRDEPLREFVSGATDLPVIVENDANVAAWAEFRYGAA
CDAEDSMVMFTIGTGVGGGIVLGGELVRGAHGIAAELGHMLSVPDGHQCGCGRLGCIEQY
ASGSALVRLARAAARQEPHRATALLKCAGGDVDAITGRMVTAAAQDGDPVSTEAFAQVGH
WLGSGLADMAQILDPQVLVVGGGVVEAGDLLLGPARTSFTAALAQRGRLPVAQICPAKLG
NNAGLIGASDLARRI
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccatcggagtggacgtcggtggcacgaaggtcgcggccggcgtcgtggac
gacacgggcacggtgctcgtgcagacccgacgggacactcccgcggatgatgtcggcaag
acctgcgacgtcatcgtcgaggtgatccgagagcttgccgagggccgggcgatcgaggga
gtcggcatcggggcggccggctggatcgacgccagtcgctcaaccgtactcttcgccccg
aacctcgcctggcgtgacgagccgctgcgcgagttcgtcagcggagccaccgacctgccg
gtgatcgtggagaacgacgccaacgtggcggcctgggcggagttccgctacggcgcggcc
tgcgacgccgaggactcgatggtcatgttcaccatcggcaccggggtcggtggtggcatc
gtgctcggcggcgagctggtacgtggcgcgcacggcatcgccgccgaactgggacacatg
ctctccgtgccggacgggcaccagtgcggctgcggccggttgggctgcatcgagcagtac
gccagcgggagcgctctggtgcggctcgcccgagccgcagcccgccaggaaccgcaccgc
gccaccgcccttctgaagtgtgccggcggcgacgttgacgcgataaccggccggatggtc
accgccgcggcgcaggacggcgacccggtctccaccgaggcgttcgcccaggtcggccac
tggctcggcagcggcctcgccgacatggcgcagatcctggacccgcaggtgttggtggtc
ggcggtggcgtcgtcgaagccggtgacctgctgctgggaccggcccgcacctccttcacc
gcggcgctcgcgcagcggggtcggctgccggtggcgcagatctgccccgccaaactcggc
aacaacgccggtctcatcggcgcctccgacctcgcccgtcggatctag

DBGET integrated database retrieval system