KEGG   Salinispora tropica: Strop_3287Help
Entry
Strop_3287        CDS       T00504                                 

Definition
GTP diphosphokinase (EC:2.7.6.5)
Orthology
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
stp  Salinispora tropica
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:stp00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3772895..3774682
Genome map
AA seq 595 aa AA seqDB search
MDVDAGHGAALEGALPPQPADLPLTRRLRTLLAWSTTDSDPVGELVRTHRNVHSGTDPSM
LRRAYTIAETMHRGQFRKSGEPYITHPLAVAQICAGLGMDATTLVAALLHDTVEDTRYTL
QALADDFGPEVAHLVDGVTKFDKAFYGKAAEAETIRKMIIAAGKDVRVLIIKLADRLHNM
RTLGVRSAASRERIARKTQEVLVPLCDRLGIQKLKRELDDMVLMHLKPEEHDRISRHLHD
RPGWDAYLAEVVSRAKTALRRSRVDAVVAPRPRHLYSIWKDTLAGDHANPFDLPRVVVVV
NGPATDCYAALGAVHGTWPPVPGRFKDYIASPKNNLYRSLHTSVRGPRDRTVEVLIRTEE
MHRCAEYGIAASYRFAHARVDQAVRDEHLDWLRRVLDWEQETADPAQFLESLRCDLAEAQ
IQVFADGQQVVLPAGATPVDLAYELGTERGDHCLATRINGRLAPLSSCLEEGDVVEIFTE
TEQTPGDFDAAPRGPRREWLGFVKSPQAQMQINRWFADHTEPGISIADKVRLGRAAVGLA
LRKHDRGLASDLPLLRLSEELGYPDLETMLVAVFDRAIEPDTVVKQLIDLVDHRR
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
gtggatgtcgacgccggacacggcgccgccttggagggcgcgcttccgccccagccggct
gatctgccgctgacccgccggctgcggacgctgctggcgtggtccaccaccgacagcgac
cccgttggtgagctggtccgcacgcatcggaacgtccactccggaacagacccgtcgatg
ctacgtcgggcgtacacgatcgccgagacgatgcaccgcgggcagttccgcaagagtggc
gaaccctacatcacccacccactcgcggtcgcccagatctgcgccggtctcggcatggac
gcgaccaccctggtcgcggcgctgctacacgacaccgtcgaggacacccgctacaccctc
caggccctcgccgacgacttcggtcccgaggtcgctcacctggtcgacggagtgaccaag
ttcgacaaggcgttctacggtaaggccgccgaggccgagacgatccgaaagatgatcatc
gcggccggcaaggacgtccgggtgttgattatcaaactggcggaccggctgcacaacatg
cgcacgctcggggttcgctccgccgcgtcccgggaacgcatcgcccgcaagacccaggag
gtactcgttccgctctgcgaccggctgggcatccagaagctcaagcgagaactggatgac
atggtgctgatgcacctgaagccggaagagcacgaccgcatctcccggcacctgcacgac
cggcccggctgggacgcgtacctggcggaggtcgtgtcccgggcgaagacggcgctacgc
cgcagccgcgtcgacgccgtggtggccccccgtccgcgccacctttactcgatctggaag
gacaccctggccggcgaccacgccaacccgtttgacctgccccgggtcgtagttgtcgtg
aacggcccggccaccgactgctacgcagctctgggcgccgtccacggcacgtggcccccg
gtgccaggccggttcaaggactacatcgcctctcccaagaacaacctctaccgctccctc
cacaccagcgtccgcgggccgagagatcgcacggtggaggtgctgatccgcaccgaggag
atgcaccgctgcgcggagtacggcatcgccgccagctatcgctttgcccatgcccgcgtg
gaccaggccgtccgggacgaacacctggactggctgcgacgcgtgctggactgggaacag
gagaccgccgatccggcgcagttcctggagtcgctgcgctgcgacctcgccgaggcgcag
atccaggtcttcgctgacgggcaacaggtggtgctgccggccggggccaccccggtcgat
ctcgcgtacgaactcggcaccgagcgcggcgaccactgcctggcgacccggatcaacggt
cgactcgccccgctctcctcctgccttgaggaaggcgatgtcgtggagatcttcaccgag
accgagcagacgcccggcgacttcgacgcggctccgcgcggtccccgccgggaatggctc
ggcttcgtcaagtccccacaagcccagatgcagatcaaccgatggttcgccgaccacacc
gaacccggaatctccatcgccgacaaggtccgcctcggccgggccgccgtcgggctggcc
ctacgcaagcacgaccgcggcctcgccagcgacctgcccctactccgactctccgaggaa
ctcggctaccccgacctggagacgatgctcgtcgcggtcttcgaccgggcgatcgaacca
gacacggtggtcaagcagctcatcgacctggttgatcatcgacggtga

DBGET integrated database retrieval system