KEGG   Salinispora tropica: Strop_3307Help
Entry
Strop_3307        CDS       T00504                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stp  Salinispora tropica
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stp00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3791577..3793046
Genome map
AA seq 489 aa AA seqDB search
MLPWATTRGCPGHRPRHRGSQDIQPHRYPAPLDALEVALTDDVLVVHGGTPLEGRIRVRG
AKNLVSKAMVAALLGDSPSRLYDLPKIRDVEVVRGLLGVHGVKVTDGDEDGALVLDPANV
ESASTDQINVHAGSSRIPILFCGPLLHRLGHAFIPDLGGCHIGPRPIDFHLQALREFGAT
VDKQPEGLHLSAPNGLHGTKFALPYPSVGATEQVLLTAVMAEGVTELRNAAVEPEIVDLI
CVLQKMGAIIKVHTDRVIEIQGVPKLHGYSHRPIPDRIEAASWAAAALATRGHVEVLGAE
QADMMTFLNIFRSVGGEYEVTDARPPRLNDPGQEGGIRFWHPGGELKSVALETDVHPGFM
TDWQQPLVVALTQARGLSIVHETVYEQRLGYTSALNSMGANIQVYRDCLGGTPCRFGRRN
FKHSAVIAGPSKLHAADLVIPDLRAGFSHLIAALAAEGTSRVYGVDLINRGYEDFEAKLA
DLGAHVERP
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctgggcgacgacacgtgggtgtcccggtcaccgaccccgtcaccgcggatcg
caggacatccaaccccaccgatacccggcaccactcgacgcgctggaggttgcgttgacc
gacgacgtcctggtcgtacacggaggcactccgctggaagggcgaattcgcgtacgcggc
gcgaagaacctggtctccaaggcgatggtcgccgcgctactcggggacagcccgagccgg
ctctacgacctaccgaagatccgtgacgtcgaggtcgtccgtggcctgctcggcgtacac
ggagtcaaggtcactgatggcgacgaggacggcgcgctggtcctcgaccccgccaacgtg
gagagcgccagcaccgaccagatcaacgtgcacgccgggtcaagcaggatcccgatcctg
ttctgcgggccactgctgcaccggcttggccacgccttcatcccggacctcggcggttgc
cacatcggcccccgcccgatcgacttccacctccaggcgctgcgcgagttcggggccacc
gtcgacaagcagccggagggcctacacctgtcggcgccgaacggcctacacggcacgaag
ttcgcgctgccctacccgagcgtcggcgccaccgagcaggtgctgctgaccgcggtgatg
gccgagggcgtcaccgagctgcgcaacgcggcggtcgagccggagatcgtcgacctgatc
tgcgtcctccagaagatgggcgcgatcatcaaggtgcacaccgaccgggtgatcgagatc
cagggcgtgccgaaactccacggctactcgcaccgcccgatcccggaccggatcgaggcg
gccagctgggccgccgccgcgctggccacccgcggccacgtcgaggtgctgggcgcggag
caggccgacatgatgacgttcctcaacatcttccgctcggtcggcggcgagtacgaggtc
accgacgcccgcccaccccggctgaacgaccccgggcaggagggcggcatccgattctgg
cacccgggcggggagctgaaatcggtcgcgctggagaccgacgtgcacccgggcttcatg
accgactggcagcaaccgctggtcgtggcactgacccaggcccgcgggctctcgatcgtt
cacgaaaccgtgtacgaacagcgactcggctacacctcggcgctgaactcgatgggtgcg
aacatccaggtctaccgggactgcctgggcggcacgccgtgtcgcttcggccggcgcaac
ttcaagcactcggcggtcatcgccgggccgagtaagttgcacgccgccgatctggtcatc
cccgacctgcgagccggtttcagccacctcatcgcggcgctcgccgccgagggcacctcc
cgggtgtatggcgtcgacctcatcaaccgcggttacgaggacttcgaggcgaagctcgcc
gacctgggcgcgcacgtcgagcgaccgtga

DBGET integrated database retrieval system