KEGG   Salinispora tropica: Strop_3320Help
Entry
Strop_3320        CDS       T00504                                 

Definition
dihydrolipoyllysine-residue succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
stp  Salinispora tropica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:stp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Strop_3320
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Strop_3320
  Amino acid metabolism
   00310 Lysine degradation
    Strop_3320
Enzymes [BR:stp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Strop_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3808749..3810578
Genome map
AA seq 609 aa AA seqDB search
MPVSVTMPRLGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLTRIV
VGEDETAEVGSELATIGDEASGDNGATGGGEAESRQSAPEPTAAAEGTGPEPEQEQEQEQ
PAPAPSGEGNPVTMPALGESVTEGTVTRWLKQVGDTVEVDEPLLEVSTDKVDTEIPSPVA
GTVLEITVAEDETADVGATLAVVGTAGAAAKPEPEAKPKPEAKPKPEAKPEPEAKPEPEA
KPEPEAKPEPKVTEPTPGASYNEPAAETESASDPAKAEQAAAPSAPASRPATTGGTENAG
YVTPLVRKLAGEHGVDLSTINGTGVGGRIRKQDVLDAAEQARAAKAAPAPAAQPAAPAAK
PAARPTPSSKRGTTEKLPRIRATIAKRMHESLHEMAQLTTVVEVDVTRIAKLRAQAKDAF
QQRHGVKLSFLPFFAQAAVEALQAYPIVNAQMDLTAGKITYPEAEHLGVAVDTERGLMVP
VIHNAGDLNLGGIAKRVADLAERTRTNKISPDELAGATFTLTNTGSRGALFDTPIVPSPQ
SAMLGTGAVVKRPVVVNDPDLGEVVAVRSMIYLALSYDHRLIDGADAARFLGTIKERLEA
GNFEAELGR
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgccggtatcggtcaccatgccccggctcggtgagagcgtcaccgagggcaccgtcacg
cgctggctcaagcaggagggcgacaccgtcgaggtcgacgagccgctgctcgaggtgtcg
accgacaaggtggacaccgagatcccgtcccccgcggccggcgtgctgacccgcatcgtg
gtcggcgaggacgagaccgccgaggtcggcagcgagctggcgacgatcggcgatgaggcg
tcgggcgacaacggggcgacgggcggcggcgaggccgagtcgcggcagtcggcgcccgag
cccaccgccgccgccgagggcacgggcccggagccggagcaggagcaggagcaggagcag
ccggctcctgcgccgtcgggcgagggcaacccggtgacgatgccggcgctcggcgagagc
gtcaccgagggcacggtcacccgctggctcaagcaggtcggcgacaccgtcgaggtcgac
gagccgctgctcgaggtgtcgaccgacaaggtggacaccgagatcccctcgccggtcgcc
gggaccgtcctggagatcaccgtggcggaggacgagaccgccgatgtcggtgcgacgctg
gcggtcgtcggcacggccggtgccgcggcgaagcccgagcccgaggcgaagcccaagccc
gaggcgaagcccaagcccgaggcgaagcccgagcccgaggcgaagcccgagcccgaggcg
aagcccgagcccgaggcgaagcccgagccgaaggtcaccgaaccgaccccgggcgcctcc
tacaacgagccggcggccgagaccgagagcgcctccgacccggcgaaggcagagcaggcc
gccgccccctcggcgcccgcctcccggccggcgacgaccggcggtacggagaacgccggc
tacgtcaccccactggtccgcaagctcgccggcgagcacggggttgacctctccacgatc
aacggcaccggcgttggtggccggatccgcaagcaggatgtgctcgacgcggccgagcag
gcccgcgccgccaaggcggctccggccccggcggcgcagcccgccgcccccgcggcgaag
cctgctgcccggcccacgcccagcagcaagcggggtaccaccgagaagctgccacggatc
cgcgcgaccatcgcgaagcggatgcacgagtcgctgcacgagatggcgcagctcaccacc
gtggtcgaggttgacgtcacccggatcgccaagctgcgggcgcaggcgaaggacgccttc
cagcagcggcacggcgtaaagctgtccttcctgccgttcttcgcccaggcggccgtcgag
gcgttgcaggcctacccgatcgtcaacgcccagatggacctgacggcggggaagatcacc
tacccggaggcggagcacctcggcgtcgccgtggacaccgagcgcggcctgatggtgccg
gtcatccacaacgccggcgacctcaacctgggtggcatcgccaagcgggtcgccgacctc
gccgagcgcacccgcaccaacaagatcagcccggatgagctcgctggtgcgacgttcacg
ctgaccaacaccggcagccggggtgccctcttcgacaccccgatcgtgccgtcgccgcag
tcggcgatgctcggcacgggtgccgtggtcaagcgcccggtcgtggtcaacgaccccgac
ctgggtgaggtcgtggccgtccggtcgatgatctacctggccctctcctacgaccaccga
ctgatcgacggtgcggacgcggcccgcttcctgggcacgatcaaggagcggctggaagcc
ggcaacttcgaggccgaactgggccggtaa

DBGET integrated database retrieval system